SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387898977|ref|YP_006329273.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387898977|ref|YP_006329273.1|
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.53e-23
Family N-acetyl transferase, NAT 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387898977|ref|YP_006329273.1|
Sequence length 156
Comment hypothetical protein MUS_2620 [Bacillus amyloliquefaciens Y2]
Sequence
MDIRTITSEDYEMVTSVLNEWWGGRQMKDKLPRLFFEHFQDTSFITYGPEGMTGFLIGFQ
SQTDPETAYIHFSGVHPDFRKMQIGKQLYDRFMETVKKRGCTKVNCVTAPVNKVSIAYHT
KLGFEVEKGTKTVNGIPVFANYDGPGEDRILFVKYM
Download sequence
Identical sequences A0A1D9PKZ0 I2C7C4
gi|384265964|ref|YP_005421671.1| gi|387898977|ref|YP_006329273.1| WP_014418298.1.10011 WP_014418298.1.100906 WP_014418298.1.13676 WP_014418298.1.46424 WP_014418298.1.53225 WP_014418298.1.55877 WP_014418298.1.55915 WP_014418298.1.55959 WP_014418298.1.62871 WP_014418298.1.66574 WP_014418298.1.76774 WP_014418298.1.79354 WP_014418298.1.89464 WP_014418298.1.96909 WP_014418298.1.97992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]