SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387899219|ref|YP_006329515.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387899219|ref|YP_006329515.1|
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.01e-16
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387899219|ref|YP_006329515.1|
Sequence length 185
Comment putative acetyltransferase [Bacillus amyloliquefaciens Y2]
Sequence
MKTKKEPKVILEPAKESDLPEFQKKLQEAFAIAVIETFGDCEGGPIPSDNDVQESFDAPG
AVVYHILRDGKKVGGAVVRINNETHHNSLDLFYVSPEYHSQGIGLSAWKAIEAQYPDTVL
WETVTPYFEKRNINFYVNKCGFHIVEFYNEHHSDPHMHRNGREDDKPLPDDDDFFRFVKI
MKKKD
Download sequence
Identical sequences A0A1D9PLM0 A0A1U3KEI3 A0A2D3DQU0 I2C816
WP_014418440.1.100906 WP_014418440.1.10853 WP_014418440.1.46424 WP_014418440.1.55877 WP_014418440.1.55915 WP_014418440.1.62871 WP_014418440.1.63713 WP_014418440.1.66574 WP_014418440.1.79354 WP_014418440.1.80415 WP_014418440.1.89464 WP_014418440.1.95227 WP_014418440.1.97992 gi|387899219|ref|YP_006329515.1| gi|384266196|ref|YP_005421903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]