SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387900012|ref|YP_006330308.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387900012|ref|YP_006330308.1|
Domain Number 1 Region: 12-150
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.56e-25
Family N-acetyl transferase, NAT 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387900012|ref|YP_006330308.1|
Sequence length 153
Comment GNAT family acetyltransferase [Bacillus amyloliquefaciens Y2]
Sequence
MQKLSIRKAAEPDEALYELLLLADPLKEIVDDYLVRGECYTAWTSDELAGVFVLLKTRPK
TVEIVNIAVKESMHNNGIGRKLIEEAVNKAKQMGAATIEIGTGNSSIGQLALYQKCGFRL
QAIDHDFFIRHYEEEIFENGIQCRDMVRLYADI
Download sequence
Identical sequences A0A2I5Q931 I2CAA9
gi|387900012|ref|YP_006330308.1| WP_014418908.1.100906 WP_014418908.1.46424 WP_014418908.1.55877 WP_014418908.1.55915 WP_014418908.1.66574 WP_014418908.1.79354 WP_014418908.1.89464 WP_014418908.1.97992 gi|384266932|ref|YP_005422639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]