SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387900062|ref|YP_006330358.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387900062|ref|YP_006330358.1|
Domain Number 1 Region: 28-191
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.81e-34
Family N-acetyl transferase, NAT 0.000000592
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387900062|ref|YP_006330358.1|
Sequence length 199
Comment protease synthase and sporulation negative regulatory protein [Bacillus amyloliquefaciens Y2]
Sequence
MFTIRYFHCKYNKKSADMINEERSCMTMSIQLKKCSLNDITELREISIETFNDTFKDQNS
PENMKAYLENAFRSEQLKKELSNLSSQFYFVYYHDDLAGYIKVNMNEAQSEKMGEDSLEI
ERIYIRKNHQKHGLGKYLLNEAVKIATAHNKKNIWLGVWEKNENAIAFYQKMGFVQTGEH
SFYMGDDKQVDFIMTKTLS
Download sequence
Identical sequences I2CAF9
gi|387900062|ref|YP_006330358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]