SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for sgtc|cn03420 from Cryptococcus neoformans B-3501A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sgtc|cn03420
Domain Number 1 Region: 40-232
Classification Level Classification E-value
Superfamily Ribosomal protein L1 2.22e-37
Family Ribosomal protein L1 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) sgtc|cn03420
Sequence length 269
Comment CNBC4140 chr03.b3501.040506 (1140841..1140891, 1140941..1141072, 1141124..1141704, 1141764..1141809)
Sequence
MISSSIRVSGRSLAQVIRPAVASASFSTTATAGARVQKKQSKKKVANPDALSASEAARVL
RALEVAHPTSTYSLTLHTKSHKSALPIRGSFTLPLDPRRTSETILVFAEPSSPSATLAKE
AGAAYVGGDELFEPVLSGKIHPTRCLATPGMMPAVTRTLARFLGPKGLMPVAKRGGVAEG
EELAERIRDAAGKMEYRADKQGTVKVNVARVDFGIPSVENNIKSFIQTVRDNQATANQTD
DPLAAAGKSKKKKGTLIHHLCDLGINKWT
Download sequence
Identical sequences Q55VS2
XP_776924.1.65578 sgtc|cn03420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]