SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for sgtc|cn06008 from Cryptococcus neoformans B-3501A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sgtc|cn06008
Domain Number 1 Region: 56-262
Classification Level Classification E-value
Superfamily Ribosomal protein L1 3.01e-38
Family Ribosomal protein L1 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) sgtc|cn06008
Sequence length 358
Comment CNBF0080 chr06.b3501.040616 (26280..26536, 26628..26897, 26981..27530)
Sequence
MAPSSALPATSKKAKKPQPTPKAPLPLPSTFSTAQAEKAVKALLAHHAKVSKQKEEEQLL
PREEHVWVVVNTKTGSTRRSLNPVKIQLPHPALPPPPTSSVCLFTKDPQRQYKDLLAQHN
IKFISRVVGVEKLKGKFKPYEARRELLRDHDMFLCDERVLGVMPKLLGKMFFEAKKQPIP
VNLQRKDLTSTLARAISSTYFHPTTGTSTSTRIATPSHSSTSQTLANLLEAVPQIVAEVD
GGWEGVLSVGIKTSGSVMLPVWTGKLGGRFEKAEKPEKSANSGEEMEVEVEEKSETPSAP
APTVEKREKKEKAAAAPVEKPKKKSSTIGSTAGGAAKRAKQVAVGAKKPAVKKSKSKL
Download sequence
Identical sequences Q55RI3
sgtc|cn06008 XP_774843.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]