SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Neudi1|86957|estExt_Genewise1.C_170046 from Neurospora discreta FGSC 8579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neudi1|86957|estExt_Genewise1.C_170046
Domain Number 1 Region: 1-211
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.056
Further Details:      
 
Weak hits

Sequence:  jgi|Neudi1|86957|estExt_Genewise1.C_170046
Domain Number - Region: 148-275,337-394
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000453
Family C-terminal domain of adrenodoxin reductase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Neudi1|86957|estExt_Genewise1.C_170046
Sequence length 701
Sequence
MRVTVIGGGPSGLVTLKYLLTAHHFLGVEPIEAHLFESDDAVGGTFHARTYEDAELVSST
QLTTFSDFRASKTDGDFLSAKRYVQYLNEYCTHFNLWPNIHLKTRVDSVTRTLKGKHVVT
YTCKPTGETSEWECDAIAVCSGLHVTPHIPEIPGIEHVPVRMHSSQFKEKKQFGVDKTVM
ILGSGETGSDLSWMAVTSQTKRVVMCHRSGFHFAPKRNLSPVLFPILGRKSSGELTVPLD
NARASLFDTAYVHPLLRNHTALWTFYNVYVRTFLWLNTGTPEGLDQVVGEPDPHKNHVSR
IFFNKSSNAAPYISYPYKHLQPSPSPPTLLSRIRSALIGSTLKDTGGRYIDLAPWPESIS
SQGIVTFQNNHRPEWERMRQQTIKPDMVIFCTGYNQEYPFFTAHNSSLKNKHGKAAKRYA
IEHKERDVRGIWNRDDSSVGFIGFLRPSLGAIPPLAEMQAQLWILQLVAPHRIPRPLEPK
EEQHYRLHHPVNSRVKYGIDHESYVYQLGLDMDSAMGVMEVLRRGLWERGIVALWERGGD
ENATWKKNTKKKQNGWKLPLVWALGANYNVKFRMKGPWRWEGTEEVMETELWTMIKRRRW
FWEHFCLSLLPMMIFGPMSLLVWVYASVVEVLLGVDDDLTRVEKGGLGVKGERRELGSKK
AMVNKVEGRWTREKMPSEAELQEKEEKTWARTDGQNWSLEV
Download sequence
Identical sequences jgi|Neudi1|86957|estExt_Genewise1.C_170046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]