SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Neudi1|93018|estExt_Genewise1Plus.C_30374 from Neurospora discreta FGSC 8579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neudi1|93018|estExt_Genewise1Plus.C_30374
Domain Number 1 Region: 138-366
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.85e-42
Family C-terminal domain of adrenodoxin reductase-like 0.0000128
Further Details:      
 
Domain Number 2 Region: 29-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000246
Family C-terminal domain of adrenodoxin reductase-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neudi1|93018|estExt_Genewise1Plus.C_30374
Sequence length 446
Sequence
MAFVARVQPRALGLRGRWPSQVHAPRRMYSQHPAHHTTHEHPLRVAVIGSGPAGFYTTYK
LMAKVQGTKVDMYESLPVPFGLNCQEKFEEVASSPDFNFIGNVSVGTKSDHPEGLTVPLA
SLFRHYNAIIFAYGAAQDRKLGIPGEDQLKGVYSAREFVGWYNGLPEHANLNPDLTQGEE
AVVIGQGNVALDVARMLLEDVDVLRKTDIATHALETLSQSRVKRVHVIGRRGPMQAAFTI
KEVRELMKLSNVSFHPVDTSLLPADLKSLPRAPRRLMEMLAKGTTATSQSPSETSKSWSL
DFCLTPKAFSPSSPSSSASAASTQLASTTFERTTLSPSPFDPNAYALPTGETVTLPSSIA
FRSIGYKSTALPEFSDINIPFDERRGIISNDGHGRVQHEERTRGAEMSHGSFPGLYCAGW
VKTGPTGQDAVLECGSEGAWVGRSEG
Download sequence
Identical sequences jgi|Neudi1|93018|estExt_Genewise1Plus.C_30374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]