SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neudi1|166945|estExt_fgenesh3_kg.C_50212 from Neurospora discreta FGSC 8579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neudi1|166945|estExt_fgenesh3_kg.C_50212
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.27e-40
Family Calponin-homology domain, CH-domain 0.0000254
Further Details:      
 
Domain Number 2 Region: 166-233
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.09e-16
Family EB1 dimerisation domain-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neudi1|166945|estExt_fgenesh3_kg.C_50212
Sequence length 248
Sequence
MGESRQELLQWINSLLQLNLTKVEQCGTGAALCQVYDSIFGDVPMSRVKFNVNSEYAYIQ
NFKILQNTFTKHQIDKSIPIEALVKCKMQDNLDFLQWTKRFWDQYFPGGDYDAAARRKGG
ALPATMSGASRASAGSAAARRPGGATPTGGPRVAARAPAASSAATQALQQEVATLKEAVG
GLERERDFYFHKLRDIEVLVQSAVEEDPELEKQEDGLIKAIQAILYSTEEGFEIPEADAE
AADDQETF
Download sequence
Identical sequences jgi|Neudi1|166945|estExt_fgenesh3_kg.C_50212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]