SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Neudi1|91430|estExt_Genewise1Plus.C_20527 from Neurospora discreta FGSC 8579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neudi1|91430|estExt_Genewise1Plus.C_20527
Domain Number 1 Region: 32-761
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-255
Family Motor proteins 0.0000000000421
Further Details:      
 
Domain Number 2 Region: 1065-1149
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-22
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Neudi1|91430|estExt_Genewise1Plus.C_20527
Sequence length 1235
Sequence
MGITRRAKDKAARAERSAGGDKSSSAKPKKATFDTTKKKEIGVSDLTLLSKVSNEAINEN
LKKRFEGREIYTYIGHVLVSVNPFRDLGIYTDQVLESYKGKNRLEMPPHVFAIAESAYYN
MKAYSENQCVIISGESGAGKTEAAKRIMQYIANVSGGGSNDIQQIKDMVLATNPLLESFG
NAKTLRNNNSSRFGKYLQIHFNAQGEPIGADITNYLLEKSRVVGQIANERNFHIFYQFTK
GASQQYREMYGIQKPETYLYTSKAKCFDVDGIDDLAEYQDTLNAMKIIGLSQQEQDNIFR
MLSAILWAGNLVFKEGDDGYAAVSDQSVVDFLAYLLEVDPAQLVHALTIRILTPRPGEVI
ESPANVPQATATRDALAMAIYYNLFDWIVERINVSLKARQATTNSIGILDIYGFEIFEKN
SFEQLCINYVNEKLQQIFIQLTLKAEQDEYAREQIKWTPIKYFDNKIVCDLIESTRPPGI
FSAMKDATKTAHADPAASDRTFMQSINGMSNPHLTPRQGAFIVKHYAGDVTYSVDGITDK
NKDLLLKGVQNLFQASQNQFVHTLFPQQVDLDNRRQPPSAGDRIRTSANALVDTLMKCQP
SYIRTIKPNENKSPTEYNEPNVLHQVKYLGLQENVRIRRAGFAYRQSFEKFVDRFFLLSP
ATSYAGEYTWTGSYEAATKQILKDTSIPQEEWQLGVTKAFIKSPETLFALEHMRDRYWHN
MATRIQRMWRAYLAYRAEAAIRIQRIWRKKRVGAEYLQLREEGHKVLGGRKERRRMSILG
SRRFLGDYLGINATTGPGAQIRSAIGIGSNEKAVFSCRGELLEHKFGRSSKPSPRILVVT
NSKFYIVAQVLNQGHVQIMAEKAFPLASIKFIGASTARDDWFSLGVGSQQEPDPLLNCVL
KTEMFTQMKRVMPGSFNLKIGDAIEYAKKPGKMQLVKVLKDAPTSQDFYKSSTVHTQPGE
PPNSVSRPQPKAKPVPPRPITKGKLIKPGGPGGRPARNANPNRTAQPRPGGGPSIAASNP
LASSAAAASSRPVPAHPGAASTPAAARSIPSHTRQQSSTSTVRPPPPPPPAPAAKPKIMA
KVLYDFAGTRENELSIKAGDIIEIVQKENNGWWLAKTAEGQAWVPAAYVEEQAPAPPVVA
PRPPPPPPPAANGGGRVAPQPPAKRPVAGRKPAPAPAVASLQNRDSGMSLNGANGSGSDA
SRSSTPTPSIAGSLADALKARKQAMAKRDDDEDDW
Download sequence
Identical sequences jgi|Neudi1|91430|estExt_Genewise1Plus.C_20527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]