SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386734509|ref|YP_006207690.1| from Bacillus anthracis str. H9401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386734509|ref|YP_006207690.1|
Domain Number 1 Region: 67-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.78e-81
Family L-arabinose binding protein-like 0.000016
Further Details:      
 
Domain Number 2 Region: 7-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.52e-18
Family GalR/LacI-like bacterial regulator 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386734509|ref|YP_006207690.1|
Sequence length 330
Comment LacI family transcriptional regulator [Bacillus anthracis str. H9401]
Sequence
MKWREKRMSTIKDVAKLAGVSVSTVSRVLNKNGYVHEDTLKKVERAIEMLDYKPSTVARS
LYNKKSRLIGLVVPNIVNPFFPEVARAVEDVAHKQGYTVVLCNSDESLEKEKQYIDVLRQ
NNVDGFIVATNPQNSVNYMNLSVPVVAIDRMFNERIPAVYADNYAGSQAATKLLIDKGCK
RIAHIRGPRDVSTANERFEGFVDVITQNNLSYMIAESTFDPANSERVAVELLEEYPHIDG
IVAGNDLIAIGIVKAALQKGISIPDDLQIIGFDGISLTEMMYPSITTVAQPIYEMGKVAT
ELLLEQMEGNVLEEKHYRLPIEIIERNTTK
Download sequence
Identical sequences A0A0F7RH74
gi|386734509|ref|YP_006207690.1| WP_014654391.1.100214 WP_014654391.1.100595 WP_014654391.1.10208 WP_014654391.1.11427 WP_014654391.1.11676 WP_014654391.1.13115 WP_014654391.1.13820 WP_014654391.1.14721 WP_014654391.1.14855 WP_014654391.1.15460 WP_014654391.1.15569 WP_014654391.1.16997 WP_014654391.1.17146 WP_014654391.1.18976 WP_014654391.1.19258 WP_014654391.1.19435 WP_014654391.1.19445 WP_014654391.1.20390 WP_014654391.1.20680 WP_014654391.1.21021 WP_014654391.1.21258 WP_014654391.1.21776 WP_014654391.1.22865 WP_014654391.1.23269 WP_014654391.1.2419 WP_014654391.1.24334 WP_014654391.1.24556 WP_014654391.1.24608 WP_014654391.1.25716 WP_014654391.1.25752 WP_014654391.1.2618 WP_014654391.1.26665 WP_014654391.1.26721 WP_014654391.1.27644 WP_014654391.1.27987 WP_014654391.1.28427 WP_014654391.1.28729 WP_014654391.1.29101 WP_014654391.1.29787 WP_014654391.1.30110 WP_014654391.1.31490 WP_014654391.1.3236 WP_014654391.1.32576 WP_014654391.1.33175 WP_014654391.1.33338 WP_014654391.1.33367 WP_014654391.1.33740 WP_014654391.1.33876 WP_014654391.1.34646 WP_014654391.1.35684 WP_014654391.1.35886 WP_014654391.1.36305 WP_014654391.1.36763 WP_014654391.1.38036 WP_014654391.1.39781 WP_014654391.1.41165 WP_014654391.1.41675 WP_014654391.1.4439 WP_014654391.1.45305 WP_014654391.1.45533 WP_014654391.1.46236 WP_014654391.1.46699 WP_014654391.1.47145 WP_014654391.1.4763 WP_014654391.1.47644 WP_014654391.1.47798 WP_014654391.1.51749 WP_014654391.1.52794 WP_014654391.1.53137 WP_014654391.1.53493 WP_014654391.1.53683 WP_014654391.1.54117 WP_014654391.1.54189 WP_014654391.1.55811 WP_014654391.1.55958 WP_014654391.1.56042 WP_014654391.1.56176 WP_014654391.1.56270 WP_014654391.1.58160 WP_014654391.1.59095 WP_014654391.1.59310 WP_014654391.1.59575 WP_014654391.1.60402 WP_014654391.1.61213 WP_014654391.1.63560 WP_014654391.1.68607 WP_014654391.1.69203 WP_014654391.1.69822 WP_014654391.1.69894 WP_014654391.1.70065 WP_014654391.1.70996 WP_014654391.1.72704 WP_014654391.1.73325 WP_014654391.1.74226 WP_014654391.1.74538 WP_014654391.1.75499 WP_014654391.1.75870 WP_014654391.1.76125 WP_014654391.1.76783 WP_014654391.1.77668 WP_014654391.1.77824 WP_014654391.1.78644 WP_014654391.1.79315 WP_014654391.1.79584 WP_014654391.1.80695 WP_014654391.1.81799 WP_014654391.1.82289 WP_014654391.1.83951 WP_014654391.1.84045 WP_014654391.1.85689 WP_014654391.1.86119 WP_014654391.1.86140 WP_014654391.1.86239 WP_014654391.1.86288 WP_014654391.1.8698 WP_014654391.1.8825 WP_014654391.1.88641 WP_014654391.1.90791 WP_014654391.1.9186 WP_014654391.1.92686 WP_014654391.1.92831 WP_014654391.1.93271 WP_014654391.1.93744 WP_014654391.1.93927 WP_014654391.1.94237 WP_014654391.1.94322 WP_014654391.1.94784 WP_014654391.1.96934 WP_014654391.1.97781 WP_014654391.1.97861 WP_014654391.1.98216 WP_014654391.1.99445 WP_014654391.1.99485 WP_014654391.1.99994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]