SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386734594|ref|YP_006207775.1| from Bacillus anthracis str. H9401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386734594|ref|YP_006207775.1|
Domain Number 1 Region: 59-311
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.19e-64
Family L-arabinose binding protein-like 0.0000874
Further Details:      
 
Domain Number 2 Region: 3-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000711
Family GalR/LacI-like bacterial regulator 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386734594|ref|YP_006207775.1|
Sequence length 328
Comment Sucrose operon repressor [Bacillus anthracis str. H9401]
Sequence
MTKTIADIAKLAGVAKSTVSRYLNGGYVSDKTKLKIESIIQETNFSPNTFAQSLKAKTTN
LIGVIIPRLDSFATMKTLIGIDNTLQENNYQMLVANANQTIETEIQAMENFIKQRVAGII
LLTKTLTNKHQQIIANSNIPILFVGQEYKDQYCLVHDDYDAAYELGAYVLSQGHRNIAYL
GVEKDDISVGINRKNGFQKAIENLEPTCSVCYYETSFHIEDAMKQVQHILDNNRPTLIVC
ATDNIALGAMKVIHSHSLSVPGDISVTGFGGYDISEMVHPSLTTIAFDYEYAGKLAATSL
SQLVENKTIPKILHSRYTLKIQESVDKI
Download sequence
Identical sequences A0A0F7RIU5 Q81UV2
gi|229603198|ref|YP_002865345.1| gi|227816374|ref|YP_002816383.1| gi|49183743|ref|YP_026995.1| gi|386734594|ref|YP_006207775.1| gi|47526038|ref|YP_017387.1| gi|30260902|ref|NP_843279.1| 198094.BA_0755 260799.BAS0719 261594.GBAA0755 568206.BAMEG_3803 592021.BAA_0863 NP_843279.1.87267 WP_000167748.1.100214 WP_000167748.1.100595 WP_000167748.1.10208 WP_000167748.1.11427 WP_000167748.1.11676 WP_000167748.1.13115 WP_000167748.1.13233 WP_000167748.1.13820 WP_000167748.1.14721 WP_000167748.1.14855 WP_000167748.1.15460 WP_000167748.1.15569 WP_000167748.1.16170 WP_000167748.1.16997 WP_000167748.1.17146 WP_000167748.1.18976 WP_000167748.1.19258 WP_000167748.1.19435 WP_000167748.1.19445 WP_000167748.1.20390 WP_000167748.1.20680 WP_000167748.1.21021 WP_000167748.1.21258 WP_000167748.1.21776 WP_000167748.1.22865 WP_000167748.1.23269 WP_000167748.1.2419 WP_000167748.1.24334 WP_000167748.1.24556 WP_000167748.1.24608 WP_000167748.1.25716 WP_000167748.1.25752 WP_000167748.1.2618 WP_000167748.1.26665 WP_000167748.1.26721 WP_000167748.1.27644 WP_000167748.1.27987 WP_000167748.1.28427 WP_000167748.1.28729 WP_000167748.1.29101 WP_000167748.1.29787 WP_000167748.1.30110 WP_000167748.1.31490 WP_000167748.1.3236 WP_000167748.1.32576 WP_000167748.1.33175 WP_000167748.1.33338 WP_000167748.1.33367 WP_000167748.1.33740 WP_000167748.1.33876 WP_000167748.1.34646 WP_000167748.1.35684 WP_000167748.1.35886 WP_000167748.1.36305 WP_000167748.1.36763 WP_000167748.1.38036 WP_000167748.1.39781 WP_000167748.1.40550 WP_000167748.1.41165 WP_000167748.1.41675 WP_000167748.1.4439 WP_000167748.1.45305 WP_000167748.1.45533 WP_000167748.1.46236 WP_000167748.1.46699 WP_000167748.1.47145 WP_000167748.1.4763 WP_000167748.1.47644 WP_000167748.1.47798 WP_000167748.1.51749 WP_000167748.1.52794 WP_000167748.1.53137 WP_000167748.1.53493 WP_000167748.1.53683 WP_000167748.1.54117 WP_000167748.1.54189 WP_000167748.1.55811 WP_000167748.1.55958 WP_000167748.1.56042 WP_000167748.1.56176 WP_000167748.1.56270 WP_000167748.1.56959 WP_000167748.1.58160 WP_000167748.1.59095 WP_000167748.1.59310 WP_000167748.1.59575 WP_000167748.1.60402 WP_000167748.1.61213 WP_000167748.1.63560 WP_000167748.1.68607 WP_000167748.1.69203 WP_000167748.1.69822 WP_000167748.1.69894 WP_000167748.1.70065 WP_000167748.1.70996 WP_000167748.1.72704 WP_000167748.1.73325 WP_000167748.1.74226 WP_000167748.1.74538 WP_000167748.1.75499 WP_000167748.1.75870 WP_000167748.1.76125 WP_000167748.1.76783 WP_000167748.1.77668 WP_000167748.1.77824 WP_000167748.1.78644 WP_000167748.1.79315 WP_000167748.1.79584 WP_000167748.1.80439 WP_000167748.1.80695 WP_000167748.1.81799 WP_000167748.1.82289 WP_000167748.1.83951 WP_000167748.1.84045 WP_000167748.1.85689 WP_000167748.1.86119 WP_000167748.1.86140 WP_000167748.1.86239 WP_000167748.1.86288 WP_000167748.1.8698 WP_000167748.1.8825 WP_000167748.1.88641 WP_000167748.1.90791 WP_000167748.1.90883 WP_000167748.1.9186 WP_000167748.1.92686 WP_000167748.1.92831 WP_000167748.1.93271 WP_000167748.1.93744 WP_000167748.1.93927 WP_000167748.1.94237 WP_000167748.1.94322 WP_000167748.1.94784 WP_000167748.1.96934 WP_000167748.1.97781 WP_000167748.1.97861 WP_000167748.1.98216 WP_000167748.1.99445 WP_000167748.1.99485 WP_000167748.1.99994 YP_026995.1.16718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]