SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386734899|ref|YP_006208080.1| from Bacillus anthracis str. H9401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386734899|ref|YP_006208080.1|
Domain Number 1 Region: 52-315
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.35e-70
Family L-arabinose binding protein-like 0.0000174
Further Details:      
 
Domain Number 2 Region: 2-53
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000356
Family GalR/LacI-like bacterial regulator 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386734899|ref|YP_006208080.1|
Sequence length 319
Comment LacI family transcriptional regulator [Bacillus anthracis str. H9401]
Sequence
MAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTETIAVLV
PRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGIILCSLEN
PWEDVEPYLQHGPIVLCNEYIEEANIPTVKFDHAQGAYIAAKHVLEQGYRNLIFCRGNET
KVVSQQRKMGFLRAITEKSRQVEAIDFLENAFSWEDGKRIFHEVLKDKKNPTAILAGGDE
VAAGIISEAKRHNWSIPDDLAVIGFDNQILSQITEPGITTIEQPIDEMARKVVDLMMDKI
HTKNYRKKELYEFELELLV
Download sequence
Identical sequences gi|386734899|ref|YP_006208080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]