SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386736257|ref|YP_006209438.1| from Bacillus anthracis str. H9401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386736257|ref|YP_006209438.1|
Domain Number 1 Region: 63-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.16e-78
Family L-arabinose binding protein-like 0.0000086
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.45e-17
Family GalR/LacI-like bacterial regulator 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386736257|ref|YP_006209438.1|
Sequence length 333
Comment transcriptional regulator [Bacillus anthracis str. H9401]
Sequence
MKPTIYDVAEKAGVSIATVSKVINQTGRISEKTINKVNQVMDELDYQPSSVAAALTGKKT
YAIGVLVPDISNPFFAEVARAFENSARESGYTLILCSTDHQTKREHEYIDLLFKKQVDGI
IIATELNDYKLVKKIVNRDLPLVLFTVDHSSITTHVVTTDDMRGGYLAGSYLMQKGHTSL
TIMMEKDRKSSLGRLNGFKQALTDSGIPLDDEAIISCYSTVEDSKRASKELLNLPNRPTA
VFACTDLIAICLMNEARKHGLSIPEDLSIIGFDNTIYAEIADPGLTTIEQPIKQMAACTF
EQLLKTMEMKEHAKQKITIIPQLVERSSVKDIT
Download sequence
Identical sequences WP_000805138.1.27644 WP_000805138.1.47798 gi|386736257|ref|YP_006209438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]