SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386736710|ref|YP_006209891.1| from Bacillus anthracis str. H9401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386736710|ref|YP_006209891.1|
Domain Number 1 Region: 34-347
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.41e-80
Family L-arabinose binding protein-like 0.00000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386736710|ref|YP_006209891.1|
Sequence length 347
Comment Sugar ABC transporter, sugar-binding protein [Bacillus anthracis str. H9401]
Sequence
MKRKLGIVFIVCICLIGLIACSSQTADKKKADDVKFAFIPKLTGVGFFTSGGEGAKEMGD
KLGVQVKYDGPSEASVSGQVKYINNFINQNYDALMVSSTSVDGLSQSLQRAKKKGMTVLT
WDSDVNPKDRSFYISQGTPDQLANLLIEMTSKQIGDKGKVAFFYSSPTVTDQNQWVTKAK
EIIKEKYPNWEIVTTQYGENNAQKSLSVGENILKTYPDINAVICPDATALPAMAQAAENL
KMDKKVVVTGFSTPNVMRDYVKRGTVQQFGLWDVKQQGALATYVANEIVVKGKKLKVGDS
FEVKGIGKVKVEPNSIQGYDYEAEGNGIIVLPERVVFTKDNIDKYNF
Download sequence
Identical sequences A0A0B6BHP6 A0A0K6MFE7 A0A0U0G635 A0A154B500 A0A158RQG3 A0A1Q4LYM0 A0A1Y6ARW7 A0A242VWN8 A0A243CX65 A0A246UPU8 B3Z4U7 F0PWZ1 Q6HHD9 Q81P43
gi|47778104|ref|YP_019617.2| gi|229603480|ref|YP_002867217.1| gi|30262932|ref|NP_845309.1| gi|49185769|ref|YP_029021.1| 198094.BA_2975 260799.BAS2763 261594.GBAA2975 281309.BT9727_2713 572264.BCA_3045 592021.BAA_3027 gi|225864938|ref|YP_002750316.1| IDP05591 gi|384180848|ref|YP_005566610.1| gi|49481798|ref|YP_037037.1| NP_845309.1.87267 WP_000823631.1.100059 WP_000823631.1.100214 WP_000823631.1.100241 WP_000823631.1.100409 WP_000823631.1.100595 WP_000823631.1.10208 WP_000823631.1.11427 WP_000823631.1.11676 WP_000823631.1.12289 WP_000823631.1.13115 WP_000823631.1.13221 WP_000823631.1.13233 WP_000823631.1.13820 WP_000823631.1.14721 WP_000823631.1.14855 WP_000823631.1.15460 WP_000823631.1.15569 WP_000823631.1.16170 WP_000823631.1.16997 WP_000823631.1.17146 WP_000823631.1.17424 WP_000823631.1.18976 WP_000823631.1.19258 WP_000823631.1.20665 WP_000823631.1.20680 WP_000823631.1.21258 WP_000823631.1.21776 WP_000823631.1.22865 WP_000823631.1.23269 WP_000823631.1.23615 WP_000823631.1.23873 WP_000823631.1.2419 WP_000823631.1.24334 WP_000823631.1.24556 WP_000823631.1.24608 WP_000823631.1.25316 WP_000823631.1.2569 WP_000823631.1.25716 WP_000823631.1.2618 WP_000823631.1.26665 WP_000823631.1.26721 WP_000823631.1.27644 WP_000823631.1.28427 WP_000823631.1.28729 WP_000823631.1.29787 WP_000823631.1.30110 WP_000823631.1.31490 WP_000823631.1.3236 WP_000823631.1.32576 WP_000823631.1.33338 WP_000823631.1.33367 WP_000823631.1.33536 WP_000823631.1.33740 WP_000823631.1.33876 WP_000823631.1.34158 WP_000823631.1.34646 WP_000823631.1.35684 WP_000823631.1.35886 WP_000823631.1.36305 WP_000823631.1.36763 WP_000823631.1.38036 WP_000823631.1.39781 WP_000823631.1.40550 WP_000823631.1.41365 WP_000823631.1.41675 WP_000823631.1.42217 WP_000823631.1.43104 WP_000823631.1.4439 WP_000823631.1.44483 WP_000823631.1.45305 WP_000823631.1.45385 WP_000823631.1.45533 WP_000823631.1.46236 WP_000823631.1.4649 WP_000823631.1.46699 WP_000823631.1.47145 WP_000823631.1.4763 WP_000823631.1.47798 WP_000823631.1.49831 WP_000823631.1.51167 WP_000823631.1.52794 WP_000823631.1.53137 WP_000823631.1.53493 WP_000823631.1.54117 WP_000823631.1.54189 WP_000823631.1.55811 WP_000823631.1.55958 WP_000823631.1.55968 WP_000823631.1.56042 WP_000823631.1.56176 WP_000823631.1.56270 WP_000823631.1.56580 WP_000823631.1.56959 WP_000823631.1.58160 WP_000823631.1.59095 WP_000823631.1.59310 WP_000823631.1.59575 WP_000823631.1.59978 WP_000823631.1.61213 WP_000823631.1.62300 WP_000823631.1.63560 WP_000823631.1.63611 WP_000823631.1.66331 WP_000823631.1.67239 WP_000823631.1.69894 WP_000823631.1.70996 WP_000823631.1.71953 WP_000823631.1.72704 WP_000823631.1.73325 WP_000823631.1.74226 WP_000823631.1.74538 WP_000823631.1.75499 WP_000823631.1.75870 WP_000823631.1.76125 WP_000823631.1.76783 WP_000823631.1.77668 WP_000823631.1.77824 WP_000823631.1.782 WP_000823631.1.78644 WP_000823631.1.79315 WP_000823631.1.79584 WP_000823631.1.80439 WP_000823631.1.80695 WP_000823631.1.80964 WP_000823631.1.81799 WP_000823631.1.83951 WP_000823631.1.84045 WP_000823631.1.85689 WP_000823631.1.85901 WP_000823631.1.86119 WP_000823631.1.86140 WP_000823631.1.86239 WP_000823631.1.86288 WP_000823631.1.8825 WP_000823631.1.90155 WP_000823631.1.90883 WP_000823631.1.91569 WP_000823631.1.9186 WP_000823631.1.92686 WP_000823631.1.92831 WP_000823631.1.93271 WP_000823631.1.93744 WP_000823631.1.93927 WP_000823631.1.94237 WP_000823631.1.94322 WP_000823631.1.94373 WP_000823631.1.94784 WP_000823631.1.96934 WP_000823631.1.97149 WP_000823631.1.97781 WP_000823631.1.97861 WP_000823631.1.98216 WP_000823631.1.99445 WP_000823631.1.99454 WP_000823631.1.99485 YP_029021.1.16718 YP_037037.1.62562 gi|386736710|ref|YP_006209891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]