SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386737616|ref|YP_006210797.1| from Bacillus anthracis str. H9401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386737616|ref|YP_006210797.1|
Domain Number 1 Region: 50-272
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000000736
Family L-arabinose binding protein-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386737616|ref|YP_006210797.1|
Sequence length 355
Comment basic membrane protein [Bacillus anthracis str. H9401]
Sequence
MKKKTGLLLSLTLAASAVLGACGNSDKASSDKKEFKVGMVTDVGGVDDKSFNQSAWEGLT
KFGKDNNLKKNEGYRYLQSSKDADYIPNLTKFAKDHYNTTFGIGYLMEKSIEKVAEQYPK
EQFAIVDTVVEKPNVTSITFKDHEGSFLVGAVAAMTTKSNKVGFVGGVKSPLITKFESGF
KAGAKAVNPNIEIVSQYADAFDKPEKGSVLASAMYGGGVDVIYHASGATGNGVFTEAKNR
KKKGENVWVIGVDRDQNQEGMPENVTLTSMVKRVDVAVAKVAQEAKDGKLKGGKVEEFGL
KDDGVGIAKTTDNVKKVNPEILTKVEEFEKKITDGEIKVPATDEEYKAYEASLKK
Download sequence
Identical sequences A0A0B5WEI7 A0A0J1I0L8 A0A0K6MX00 A0A0U0ELR0 A0A150AZR3 A0A158RP57 A0A242W9C9 A0A243BAK8 A0A243CSA4 A0A243I5D6 A0RHG3 B3Z5T4 B3ZMV3 B7JJ70 C2NLJ6 C2TKB3 C3G6U3 C3GMP7 D8H7Y6 Q6HF23 Q81WP4
gi|49478376|ref|YP_037853.1| gi|30263795|ref|NP_846172.1| gi|229603433|ref|YP_002868032.1| 198094.BA_3927 260799.BAS3643 261594.GBAA3927 281309.BT9727_3533 405535.BCAH820_3804 412694.BALH_3420 568206.BAMEG_0702 572264.BCA_3888 592021.BAA_3954 IDP05726 gi|49186642|ref|YP_029894.1| gi|118479012|ref|YP_896163.1| gi|218904920|ref|YP_002452754.1| gi|301055282|ref|YP_003793493.1| NP_846172.1.87267 WP_000730595.1.100059 WP_000730595.1.100409 WP_000730595.1.100595 WP_000730595.1.101931 WP_000730595.1.10208 WP_000730595.1.11387 WP_000730595.1.11427 WP_000730595.1.11676 WP_000730595.1.13115 WP_000730595.1.13221 WP_000730595.1.13233 WP_000730595.1.13820 WP_000730595.1.14721 WP_000730595.1.14855 WP_000730595.1.14882 WP_000730595.1.15163 WP_000730595.1.15460 WP_000730595.1.15569 WP_000730595.1.16013 WP_000730595.1.16156 WP_000730595.1.16170 WP_000730595.1.16199 WP_000730595.1.17146 WP_000730595.1.17424 WP_000730595.1.17927 WP_000730595.1.18976 WP_000730595.1.19258 WP_000730595.1.19435 WP_000730595.1.19445 WP_000730595.1.20390 WP_000730595.1.20680 WP_000730595.1.21021 WP_000730595.1.21258 WP_000730595.1.21776 WP_000730595.1.22865 WP_000730595.1.23269 WP_000730595.1.23615 WP_000730595.1.23873 WP_000730595.1.2419 WP_000730595.1.24334 WP_000730595.1.24556 WP_000730595.1.24608 WP_000730595.1.24676 WP_000730595.1.24709 WP_000730595.1.25316 WP_000730595.1.2569 WP_000730595.1.25716 WP_000730595.1.25752 WP_000730595.1.26000 WP_000730595.1.2618 WP_000730595.1.26665 WP_000730595.1.26721 WP_000730595.1.27644 WP_000730595.1.27987 WP_000730595.1.28427 WP_000730595.1.28729 WP_000730595.1.29101 WP_000730595.1.29787 WP_000730595.1.29804 WP_000730595.1.30110 WP_000730595.1.30216 WP_000730595.1.31490 WP_000730595.1.32576 WP_000730595.1.33175 WP_000730595.1.33338 WP_000730595.1.33367 WP_000730595.1.33536 WP_000730595.1.33740 WP_000730595.1.33828 WP_000730595.1.33876 WP_000730595.1.34158 WP_000730595.1.34646 WP_000730595.1.35886 WP_000730595.1.36305 WP_000730595.1.36763 WP_000730595.1.38036 WP_000730595.1.39781 WP_000730595.1.40550 WP_000730595.1.41165 WP_000730595.1.41365 WP_000730595.1.42217 WP_000730595.1.43104 WP_000730595.1.4439 WP_000730595.1.44483 WP_000730595.1.45305 WP_000730595.1.45385 WP_000730595.1.45533 WP_000730595.1.45919 WP_000730595.1.46236 WP_000730595.1.46476 WP_000730595.1.46549 WP_000730595.1.46699 WP_000730595.1.47145 WP_000730595.1.4763 WP_000730595.1.47644 WP_000730595.1.47798 WP_000730595.1.51749 WP_000730595.1.52794 WP_000730595.1.53137 WP_000730595.1.53493 WP_000730595.1.53683 WP_000730595.1.53879 WP_000730595.1.54117 WP_000730595.1.54189 WP_000730595.1.55811 WP_000730595.1.55958 WP_000730595.1.55968 WP_000730595.1.56042 WP_000730595.1.56176 WP_000730595.1.56270 WP_000730595.1.56318 WP_000730595.1.56580 WP_000730595.1.56959 WP_000730595.1.58160 WP_000730595.1.59095 WP_000730595.1.59173 WP_000730595.1.59310 WP_000730595.1.59575 WP_000730595.1.59978 WP_000730595.1.60402 WP_000730595.1.60841 WP_000730595.1.61213 WP_000730595.1.62300 WP_000730595.1.63137 WP_000730595.1.63560 WP_000730595.1.63611 WP_000730595.1.64491 WP_000730595.1.66331 WP_000730595.1.66357 WP_000730595.1.67239 WP_000730595.1.68607 WP_000730595.1.69203 WP_000730595.1.69323 WP_000730595.1.69822 WP_000730595.1.69894 WP_000730595.1.70065 WP_000730595.1.7096 WP_000730595.1.70996 WP_000730595.1.71895 WP_000730595.1.72704 WP_000730595.1.73325 WP_000730595.1.74226 WP_000730595.1.7545 WP_000730595.1.75499 WP_000730595.1.75870 WP_000730595.1.76783 WP_000730595.1.77668 WP_000730595.1.77824 WP_000730595.1.782 WP_000730595.1.7856 WP_000730595.1.78644 WP_000730595.1.79315 WP_000730595.1.79584 WP_000730595.1.80439 WP_000730595.1.80695 WP_000730595.1.81799 WP_000730595.1.82289 WP_000730595.1.83951 WP_000730595.1.84045 WP_000730595.1.85689 WP_000730595.1.85901 WP_000730595.1.86119 WP_000730595.1.86140 WP_000730595.1.86239 WP_000730595.1.86288 WP_000730595.1.8698 WP_000730595.1.8825 WP_000730595.1.88641 WP_000730595.1.89675 WP_000730595.1.90155 WP_000730595.1.90596 WP_000730595.1.90791 WP_000730595.1.90883 WP_000730595.1.9186 WP_000730595.1.92686 WP_000730595.1.9269 WP_000730595.1.92831 WP_000730595.1.93744 WP_000730595.1.93893 WP_000730595.1.93927 WP_000730595.1.94237 WP_000730595.1.94322 WP_000730595.1.94373 WP_000730595.1.94784 WP_000730595.1.95786 WP_000730595.1.96934 WP_000730595.1.97149 WP_000730595.1.97781 WP_000730595.1.97861 WP_000730595.1.98216 WP_000730595.1.99445 WP_000730595.1.99454 WP_000730595.1.99485 WP_000730595.1.99994 YP_029894.1.16718 YP_037853.1.62562 gi|225865772|ref|YP_002751150.1| gi|386737616|ref|YP_006210797.1| gi|227813299|ref|YP_002813308.1| gi|47529220|ref|YP_020569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]