SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386737999|ref|YP_006211180.1| from Bacillus anthracis str. H9401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386737999|ref|YP_006211180.1|
Domain Number 1 Region: 58-287
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.42e-37
Family L-arabinose binding protein-like 0.001
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.48e-17
Family GalR/LacI-like bacterial regulator 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386737999|ref|YP_006211180.1|
Sequence length 287
Comment LacI family sugar-binding transcriptional regulator [Bacillus anthracis str. H9401]
Sequence
MATIRDVAKLAGVSVATVSRVMNEKGYVHEDTVKQVKEAIEELRYRPNSAAKPLFKENST
IIALLVDNLYNPSNITLLHCIEEIAYKEGYQIIVCNIENKDRCIHMLKENNVAGVILTRS
VFKSIGEIPLPFVVIDEKKSHVNYYESGQRAVSLLKEKGCHFLAYFGEGEDSEEMENRIS
GFLDAVWEGGISYREVCVQGYTNKQFITLLRNNPYIDGIVTESDKVTFELIQAAKNLNIR
IPDKLKIIGLNGSIDSEWIGSSFMKIESCIEENGEIALQQLKEKIKK
Download sequence
Identical sequences A0A0F7R712 Q81MC3
gi|227816883|ref|YP_002816892.1| 198094.BA_4326 260799.BAS4013 261594.GBAA4326 568206.BAMEG_4365 592021.BAA_4347 gi|47778279|ref|YP_020973.2| gi|49187011|ref|YP_030263.1| NP_846559.1.87267 WP_000201376.1.100214 WP_000201376.1.100595 WP_000201376.1.10208 WP_000201376.1.11427 WP_000201376.1.11676 WP_000201376.1.13115 WP_000201376.1.13233 WP_000201376.1.13820 WP_000201376.1.14721 WP_000201376.1.14855 WP_000201376.1.15460 WP_000201376.1.15569 WP_000201376.1.16170 WP_000201376.1.16997 WP_000201376.1.17146 WP_000201376.1.19435 WP_000201376.1.19445 WP_000201376.1.20390 WP_000201376.1.20680 WP_000201376.1.21021 WP_000201376.1.21258 WP_000201376.1.21776 WP_000201376.1.22865 WP_000201376.1.23269 WP_000201376.1.2419 WP_000201376.1.24556 WP_000201376.1.24608 WP_000201376.1.25752 WP_000201376.1.2618 WP_000201376.1.26665 WP_000201376.1.27644 WP_000201376.1.27987 WP_000201376.1.28427 WP_000201376.1.28729 WP_000201376.1.29101 WP_000201376.1.29787 WP_000201376.1.30110 WP_000201376.1.31490 WP_000201376.1.3236 WP_000201376.1.33175 WP_000201376.1.33338 WP_000201376.1.33367 WP_000201376.1.33536 WP_000201376.1.33740 WP_000201376.1.33876 WP_000201376.1.34646 WP_000201376.1.35684 WP_000201376.1.35886 WP_000201376.1.36305 WP_000201376.1.36763 WP_000201376.1.38036 WP_000201376.1.39781 WP_000201376.1.40550 WP_000201376.1.41165 WP_000201376.1.41675 WP_000201376.1.4439 WP_000201376.1.45305 WP_000201376.1.45533 WP_000201376.1.46236 WP_000201376.1.46699 WP_000201376.1.47145 WP_000201376.1.4763 WP_000201376.1.47644 WP_000201376.1.47798 WP_000201376.1.51749 WP_000201376.1.52794 WP_000201376.1.53137 WP_000201376.1.53493 WP_000201376.1.53683 WP_000201376.1.54117 WP_000201376.1.54189 WP_000201376.1.55811 WP_000201376.1.55958 WP_000201376.1.56042 WP_000201376.1.56270 WP_000201376.1.56959 WP_000201376.1.58160 WP_000201376.1.59095 WP_000201376.1.59310 WP_000201376.1.59575 WP_000201376.1.60402 WP_000201376.1.63560 WP_000201376.1.68607 WP_000201376.1.69203 WP_000201376.1.69822 WP_000201376.1.69894 WP_000201376.1.70065 WP_000201376.1.70996 WP_000201376.1.72704 WP_000201376.1.73325 WP_000201376.1.74538 WP_000201376.1.75499 WP_000201376.1.75870 WP_000201376.1.76125 WP_000201376.1.76783 WP_000201376.1.77668 WP_000201376.1.79315 WP_000201376.1.79584 WP_000201376.1.80439 WP_000201376.1.80695 WP_000201376.1.81799 WP_000201376.1.82289 WP_000201376.1.83951 WP_000201376.1.84045 WP_000201376.1.85689 WP_000201376.1.86119 WP_000201376.1.86140 WP_000201376.1.86239 WP_000201376.1.86288 WP_000201376.1.88641 WP_000201376.1.90791 WP_000201376.1.90883 WP_000201376.1.9186 WP_000201376.1.92686 WP_000201376.1.92831 WP_000201376.1.93271 WP_000201376.1.93744 WP_000201376.1.93927 WP_000201376.1.94237 WP_000201376.1.94322 WP_000201376.1.94784 WP_000201376.1.96934 WP_000201376.1.97781 WP_000201376.1.97861 WP_000201376.1.99445 WP_000201376.1.99485 WP_000201376.1.99994 YP_030263.1.16718 gi|30264182|ref|NP_846559.1| gi|386737999|ref|YP_006211180.1| gi|229600624|ref|YP_002868405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]