SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386738100|ref|YP_006211281.1| from Bacillus anthracis str. H9401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386738100|ref|YP_006211281.1|
Domain Number 1 Region: 61-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-59
Family L-arabinose binding protein-like 0.0000528
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.98e-18
Family GalR/LacI-like bacterial regulator 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386738100|ref|YP_006211281.1|
Sequence length 325
Comment LacI family transcriptional regulator [Bacillus anthracis str. H9401]
Sequence
MANIKQIAKTAGVSISTVSRVLNNHPYVKEEKRKRVLDAVEELNYAKNINAIHLIKGKTY
TIGVMLPFINLPYFSTIIEGIGNEALAAGYHINLCQTNYDSIEEIRVLEMMKMKQFDGMI
ICSRTSSWEQIEPFAKFAPIISCEKMNHPLISSVYVDHYEGFRLGTAYLLKKGHEKIGIC
LARKTSANSMEREKAFADTLRKEGKTLHPEWIFHQCYTMQDGAQLLHRIVNMKNRPTAIF
TANDQVAAGLVTEARKQGLRVPEDLAILGFDNHEISKALEISTIEHPGLAMGSHAFSLFH
KQMQSEQIIGNAKELSFHLIERDTV
Download sequence
Identical sequences A0A0B5NDK3 A0A0K6KNF5 A0A1S9AXG6 A0A243CNV0 B7JMT4 C2TLA4 C3GNE2 Q81M22
gi|30264284|ref|NP_846661.1| gi|47778294|ref|YP_022692.1| gi|227816985|ref|YP_002816994.1| gi|218905346|ref|YP_002453180.1| gi|386738100|ref|YP_006211281.1| 198094.BA_4433 260799.BAS4113 261594.GBAA4433 405535.BCAH820_4230 568206.BAMEG_4468 NP_846661.1.87267 WP_001273966.1.100059 WP_001273966.1.100214 WP_001273966.1.100409 WP_001273966.1.100595 WP_001273966.1.10208 WP_001273966.1.11427 WP_001273966.1.11676 WP_001273966.1.13115 WP_001273966.1.13233 WP_001273966.1.13820 WP_001273966.1.14721 WP_001273966.1.14855 WP_001273966.1.15460 WP_001273966.1.15569 WP_001273966.1.16013 WP_001273966.1.16156 WP_001273966.1.16170 WP_001273966.1.16997 WP_001273966.1.17146 WP_001273966.1.18976 WP_001273966.1.19258 WP_001273966.1.19435 WP_001273966.1.19445 WP_001273966.1.20390 WP_001273966.1.20680 WP_001273966.1.21021 WP_001273966.1.21258 WP_001273966.1.21776 WP_001273966.1.22865 WP_001273966.1.23269 WP_001273966.1.23615 WP_001273966.1.2419 WP_001273966.1.24334 WP_001273966.1.24556 WP_001273966.1.24608 WP_001273966.1.25716 WP_001273966.1.25752 WP_001273966.1.2618 WP_001273966.1.26665 WP_001273966.1.26721 WP_001273966.1.27644 WP_001273966.1.27987 WP_001273966.1.28427 WP_001273966.1.28729 WP_001273966.1.29101 WP_001273966.1.29787 WP_001273966.1.29804 WP_001273966.1.30110 WP_001273966.1.30216 WP_001273966.1.31490 WP_001273966.1.3236 WP_001273966.1.32576 WP_001273966.1.33175 WP_001273966.1.33338 WP_001273966.1.33367 WP_001273966.1.33740 WP_001273966.1.33876 WP_001273966.1.34646 WP_001273966.1.35684 WP_001273966.1.35886 WP_001273966.1.36305 WP_001273966.1.36763 WP_001273966.1.38036 WP_001273966.1.39781 WP_001273966.1.40550 WP_001273966.1.41165 WP_001273966.1.41675 WP_001273966.1.42217 WP_001273966.1.4439 WP_001273966.1.45305 WP_001273966.1.45533 WP_001273966.1.45919 WP_001273966.1.46236 WP_001273966.1.46549 WP_001273966.1.46699 WP_001273966.1.47145 WP_001273966.1.4763 WP_001273966.1.47644 WP_001273966.1.47798 WP_001273966.1.51749 WP_001273966.1.52794 WP_001273966.1.53137 WP_001273966.1.53493 WP_001273966.1.53683 WP_001273966.1.53879 WP_001273966.1.54117 WP_001273966.1.54189 WP_001273966.1.55811 WP_001273966.1.55958 WP_001273966.1.56042 WP_001273966.1.56176 WP_001273966.1.56270 WP_001273966.1.56318 WP_001273966.1.56959 WP_001273966.1.58160 WP_001273966.1.59095 WP_001273966.1.59173 WP_001273966.1.59310 WP_001273966.1.59575 WP_001273966.1.60402 WP_001273966.1.61213 WP_001273966.1.63137 WP_001273966.1.63560 WP_001273966.1.63611 WP_001273966.1.64491 WP_001273966.1.68607 WP_001273966.1.69203 WP_001273966.1.69822 WP_001273966.1.69894 WP_001273966.1.70065 WP_001273966.1.7096 WP_001273966.1.70996 WP_001273966.1.72704 WP_001273966.1.73325 WP_001273966.1.74226 WP_001273966.1.74538 WP_001273966.1.7545 WP_001273966.1.75499 WP_001273966.1.75870 WP_001273966.1.76125 WP_001273966.1.76783 WP_001273966.1.77668 WP_001273966.1.77824 WP_001273966.1.78644 WP_001273966.1.79315 WP_001273966.1.79584 WP_001273966.1.80439 WP_001273966.1.80695 WP_001273966.1.81799 WP_001273966.1.82289 WP_001273966.1.83951 WP_001273966.1.84045 WP_001273966.1.85689 WP_001273966.1.86119 WP_001273966.1.86140 WP_001273966.1.86239 WP_001273966.1.86288 WP_001273966.1.8698 WP_001273966.1.8825 WP_001273966.1.88641 WP_001273966.1.90596 WP_001273966.1.90791 WP_001273966.1.90883 WP_001273966.1.9186 WP_001273966.1.92686 WP_001273966.1.92831 WP_001273966.1.93271 WP_001273966.1.93744 WP_001273966.1.93893 WP_001273966.1.93927 WP_001273966.1.94237 WP_001273966.1.94322 WP_001273966.1.94784 WP_001273966.1.95308 WP_001273966.1.96934 WP_001273966.1.97781 WP_001273966.1.97861 WP_001273966.1.98216 WP_001273966.1.99445 WP_001273966.1.99485 WP_001273966.1.99994 YP_030363.1.16718 gi|49187111|ref|YP_030363.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]