SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386739067|ref|YP_006212248.1| from Bacillus anthracis str. H9401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386739067|ref|YP_006212248.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.22e-38
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386739067|ref|YP_006212248.1|
Sequence length 105
Comment PTS system cellobiose-specific transporter subunit IIA [Bacillus anthracis str. H9401]
Sequence
MDTIETKAFHLILHGGNARSCSMEAIDCAKRGEFTEAEAKLQEALEELKEAHRVQTDLIQ
KEAGGEKTEVTLLMVHAQDHLMNAITVKELASEFVELYRKMSVTE
Download sequence
Identical sequences A0A0B5NXD0 A0A0G8DUE8 A0A0J1HTH8 A0A0K6MEV5 A0A0T8VT30 A0A154B296 A0A158RGK3 A0A1J9Z9Y9 A0A1S9BML2 A0A229MD73 A0A243B6M0 A0A243NPU4 A0A2K1RZI9 B3Z8S0 B3ZR12 B7JGD7 B9J5L8 C2NQG5 C2W1L8 D8H2U1 Q631E0 Q6HB73 Q72XQ1 Q81X03
gi|386739067|ref|YP_006212248.1| gi|49188048|ref|YP_031301.1| gi|229604727|ref|YP_002869432.1| gi|218906389|ref|YP_002454223.1| gi|49481192|ref|YP_039203.1| gi|227817972|ref|YP_002817981.1| gi|47530761|ref|YP_022110.1| gi|30265238|ref|NP_847615.1| gi|301056674|ref|YP_003794885.1| gi|222098670|ref|YP_002532728.1| 198094.BA_5447 222523.BCE_5324 260799.BAS5062 261594.GBAA5447 281309.BT9727_4894 288681.BCZK4907 361100.BCQ_5039 405535.BCAH820_5303 568206.BAMEG_5497 572264.BCA_5346 592021.BAA_5475 gi|225867179|ref|YP_002752557.1| NP_847615.1.87267 WP_000379638.1.100059 WP_000379638.1.100214 WP_000379638.1.100595 WP_000379638.1.100684 WP_000379638.1.10069 WP_000379638.1.101309 WP_000379638.1.101931 WP_000379638.1.10208 WP_000379638.1.10762 WP_000379638.1.11387 WP_000379638.1.11427 WP_000379638.1.11676 WP_000379638.1.1228 WP_000379638.1.12289 WP_000379638.1.12751 WP_000379638.1.13024 WP_000379638.1.13115 WP_000379638.1.13221 WP_000379638.1.13233 WP_000379638.1.13299 WP_000379638.1.13820 WP_000379638.1.14721 WP_000379638.1.14855 WP_000379638.1.14882 WP_000379638.1.15460 WP_000379638.1.15569 WP_000379638.1.16013 WP_000379638.1.16156 WP_000379638.1.16170 WP_000379638.1.16997 WP_000379638.1.17146 WP_000379638.1.17408 WP_000379638.1.17424 WP_000379638.1.17927 WP_000379638.1.18840 WP_000379638.1.18976 WP_000379638.1.19258 WP_000379638.1.19435 WP_000379638.1.19445 WP_000379638.1.20390 WP_000379638.1.20680 WP_000379638.1.20687 WP_000379638.1.20865 WP_000379638.1.21021 WP_000379638.1.21258 WP_000379638.1.21776 WP_000379638.1.22865 WP_000379638.1.23269 WP_000379638.1.23615 WP_000379638.1.23873 WP_000379638.1.24184 WP_000379638.1.2419 WP_000379638.1.24334 WP_000379638.1.24377 WP_000379638.1.24556 WP_000379638.1.24608 WP_000379638.1.24676 WP_000379638.1.24759 WP_000379638.1.25316 WP_000379638.1.2569 WP_000379638.1.25716 WP_000379638.1.25752 WP_000379638.1.26000 WP_000379638.1.2618 WP_000379638.1.26499 WP_000379638.1.26665 WP_000379638.1.26721 WP_000379638.1.27334 WP_000379638.1.27644 WP_000379638.1.27987 WP_000379638.1.28427 WP_000379638.1.28729 WP_000379638.1.29101 WP_000379638.1.29209 WP_000379638.1.29451 WP_000379638.1.29787 WP_000379638.1.29804 WP_000379638.1.30110 WP_000379638.1.30216 WP_000379638.1.30336 WP_000379638.1.31490 WP_000379638.1.31685 WP_000379638.1.3236 WP_000379638.1.32522 WP_000379638.1.32576 WP_000379638.1.33045 WP_000379638.1.33061 WP_000379638.1.33175 WP_000379638.1.3318 WP_000379638.1.33338 WP_000379638.1.33367 WP_000379638.1.33536 WP_000379638.1.33740 WP_000379638.1.33876 WP_000379638.1.34158 WP_000379638.1.34646 WP_000379638.1.35684 WP_000379638.1.35886 WP_000379638.1.3615 WP_000379638.1.36305 WP_000379638.1.36763 WP_000379638.1.37093 WP_000379638.1.37990 WP_000379638.1.38036 WP_000379638.1.39001 WP_000379638.1.39781 WP_000379638.1.40550 WP_000379638.1.41165 WP_000379638.1.41675 WP_000379638.1.42217 WP_000379638.1.43104 WP_000379638.1.43762 WP_000379638.1.4439 WP_000379638.1.44463 WP_000379638.1.44483 WP_000379638.1.45089 WP_000379638.1.45305 WP_000379638.1.45385 WP_000379638.1.45533 WP_000379638.1.45919 WP_000379638.1.46236 WP_000379638.1.4649 WP_000379638.1.46549 WP_000379638.1.46699 WP_000379638.1.46746 WP_000379638.1.46864 WP_000379638.1.47097 WP_000379638.1.47145 WP_000379638.1.4763 WP_000379638.1.47644 WP_000379638.1.47798 WP_000379638.1.48164 WP_000379638.1.48311 WP_000379638.1.48599 WP_000379638.1.4865 WP_000379638.1.49428 WP_000379638.1.49802 WP_000379638.1.49831 WP_000379638.1.50316 WP_000379638.1.50514 WP_000379638.1.51087 WP_000379638.1.51749 WP_000379638.1.52756 WP_000379638.1.52794 WP_000379638.1.53137 WP_000379638.1.53493 WP_000379638.1.53683 WP_000379638.1.53879 WP_000379638.1.54117 WP_000379638.1.54189 WP_000379638.1.54775 WP_000379638.1.54782 WP_000379638.1.55057 WP_000379638.1.55811 WP_000379638.1.55958 WP_000379638.1.56042 WP_000379638.1.56055 WP_000379638.1.56176 WP_000379638.1.56270 WP_000379638.1.56318 WP_000379638.1.56959 WP_000379638.1.57203 WP_000379638.1.57815 WP_000379638.1.57859 WP_000379638.1.58160 WP_000379638.1.58814 WP_000379638.1.59095 WP_000379638.1.59173 WP_000379638.1.59310 WP_000379638.1.59575 WP_000379638.1.59773 WP_000379638.1.60274 WP_000379638.1.60402 WP_000379638.1.60841 WP_000379638.1.61213 WP_000379638.1.63137 WP_000379638.1.63560 WP_000379638.1.64377 WP_000379638.1.64491 WP_000379638.1.65758 WP_000379638.1.66331 WP_000379638.1.66357 WP_000379638.1.6753 WP_000379638.1.68607 WP_000379638.1.69203 WP_000379638.1.69323 WP_000379638.1.69894 WP_000379638.1.70065 WP_000379638.1.70645 WP_000379638.1.7096 WP_000379638.1.70996 WP_000379638.1.71895 WP_000379638.1.72514 WP_000379638.1.72704 WP_000379638.1.73325 WP_000379638.1.74226 WP_000379638.1.74538 WP_000379638.1.7545 WP_000379638.1.75499 WP_000379638.1.75870 WP_000379638.1.76125 WP_000379638.1.76783 WP_000379638.1.77576 WP_000379638.1.77668 WP_000379638.1.77690 WP_000379638.1.77824 WP_000379638.1.77902 WP_000379638.1.782 WP_000379638.1.7856 WP_000379638.1.78644 WP_000379638.1.79043 WP_000379638.1.79315 WP_000379638.1.79584 WP_000379638.1.79658 WP_000379638.1.80439 WP_000379638.1.80695 WP_000379638.1.81088 WP_000379638.1.81799 WP_000379638.1.82289 WP_000379638.1.82533 WP_000379638.1.82986 WP_000379638.1.83951 WP_000379638.1.84045 WP_000379638.1.84337 WP_000379638.1.8450 WP_000379638.1.85689 WP_000379638.1.86119 WP_000379638.1.86140 WP_000379638.1.86239 WP_000379638.1.86288 WP_000379638.1.8698 WP_000379638.1.8825 WP_000379638.1.8923 WP_000379638.1.89675 WP_000379638.1.90596 WP_000379638.1.90791 WP_000379638.1.90883 WP_000379638.1.91404 WP_000379638.1.91615 WP_000379638.1.9186 WP_000379638.1.92347 WP_000379638.1.92686 WP_000379638.1.9269 WP_000379638.1.92831 WP_000379638.1.93271 WP_000379638.1.93744 WP_000379638.1.93893 WP_000379638.1.93927 WP_000379638.1.93932 WP_000379638.1.94237 WP_000379638.1.94322 WP_000379638.1.94373 WP_000379638.1.94784 WP_000379638.1.95308 WP_000379638.1.95457 WP_000379638.1.95484 WP_000379638.1.95786 WP_000379638.1.96934 WP_000379638.1.97149 WP_000379638.1.97781 WP_000379638.1.97861 WP_000379638.1.98216 WP_000379638.1.99266 WP_000379638.1.99445 WP_000379638.1.99454 WP_000379638.1.99485 WP_000379638.1.99994 YP_031301.1.16718 YP_039203.1.62562 gi|52140352|ref|YP_086477.1| gi|42784369|ref|NP_981616.1| gi|375287226|ref|YP_005107665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]