SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|115383|estExt_Genewise1Plus.C_50618 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|115383|estExt_Genewise1Plus.C_50618
Domain Number 1 Region: 48-261
Classification Level Classification E-value
Superfamily ITPase-like 1.37e-45
Family Maf-like 0.00004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|115383|estExt_Genewise1Plus.C_50618
Sequence length 290
Sequence
MDPTAPEPENPPAYIAAARRHGIPLRQSAPIKRGPMPLQLPILDHLRTKRVILASASPRR
KALLNQLGLNDVEIFPSDKPEDVEKGKITPEEYVAETARRKILHVYEQALRQQEEDEQNK
NVEKPADPALVISADTVIATRSGRILEKPRDEQDHIRMLKHLRDTRVHRVLTAVCVLAPK
DNAAHPGYELETHVEDTEVYFAQARDGLPDDVIEAYVKTREGADKAGGYAIQGIGGMVLI
DKIEGSVDNVVGLPVRKTLQLAEKVIFKQGIEDDDIGSDEEDDDEEPYQD
Download sequence
Identical sequences F8N4E7
XP_009856326.1.73169 jgi|Neute1|115383|estExt_Genewise1Plus.C_50618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]