SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|168021|estExt_fgenesh1_pm.C_410036 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|168021|estExt_fgenesh1_pm.C_410036
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.57e-31
Family Nip7p homolog, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 96-171
Classification Level Classification E-value
Superfamily PUA domain-like 2.27e-24
Family PUA domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|168021|estExt_fgenesh1_pm.C_410036
Sequence length 183
Sequence
MRPLTETEQKTVFEKLANYCTDLKSLIAPLDDGDRYVFRLNHSRVYYVRLSVANLATSVS
RDALLSLGTCLGKMTKTGKFRLHITALPILSEHARHKIWVKDNGAQPFLYGSNVVKAHVG
RWSEDCPEHSGVVVYSMADIPLGFGVTARSTTEARRLDPTGIVCFRQSDCGEYLRDEDTL
FAG
Download sequence
Identical sequences A0A0B0EAW0 F7W9I4 F8MMC6 G4UR28 Q7RYM3
jgi|Neute1|168021|estExt_fgenesh1_pm.C_410036 jgi|Neudi1|97188|estExt_Genewise1Plus.C_51159 NCU00105T0 XP_003347204.1.50522 XP_009850891.1.73169 XP_957229.2.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]