SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|92904|estExt_Genewise1.C_10945 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|92904|estExt_Genewise1.C_10945
Domain Number 1 Region: 11-187
Classification Level Classification E-value
Superfamily ITPase-like 1.96e-58
Family ITPase (Ham1) 0.00000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|92904|estExt_Genewise1.C_10945
Sequence length 191
Sequence
MSAPSQARHIVNFITGNANKLGEVKAILEPAIQVENQALDLLEIQGTLEEVTLDKCRRAA
DLVQGPVLVEDTCLCFNALKGLPGPYIKWFMNSLGHEGLNNLLAAYEDKSAKAVCTFGYS
AGPGHEPILFQGITDGKIVPPRGPPNFGWDAIFEYEGQTYAEMDKAEKNKISHRAKALAK
LQEWFAKEMTA
Download sequence
Identical sequences A0A0B0DKP5 F8MCN4 G4UHR0 Q1K4R6
NCU01441T0 XP_009847259.1.73169 XP_955963.1.24337 jgi|Neute1|92904|estExt_Genewise1.C_10945 5141.NCU01441.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]