SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|106365|estExt_Genewise1.C_270034 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|106365|estExt_Genewise1.C_270034
Domain Number 1 Region: 7-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000156
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 2 Region: 68-103
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000011
Family Zn2/Cys6 DNA-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  jgi|Neute1|106365|estExt_Genewise1.C_270034
Domain Number - Region: 430-482
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000112
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|106365|estExt_Genewise1.C_270034
Sequence length 941
Sequence
MSEAAPVHRCPVCYKTYKRREHLQRHRASHTSERPHRCILCSASFQRTDVLKRHIQTCDG
LPHGSSGRRRACDRCVRQKKACNSAQPCQNCSKRAVQCLYSSVNSSSTSQDGEAGSTSAA
NSVESFSNTPSTQQQQQQQQQQPQQQQQQQQQTQQYQHQQFLHQQPQQLHQQQQQQQQQQ
EQQQRQQQRQQQQQHQHQQQQHQPIYLQQQHQYQHQQHHHQQQQQQQQQHPQRPQHHQFQ
PQQHQQQTYQQHPHQQQHNQQQRHHHNVLHAQVTHPLTQIPQIAPVPVPQIPRNHQVPVP
QILQQSHQSHQPHPAHQPHHVPFNHPGVAHFDDLDNLLHDAAGQFPMLGHQDTHIPDWIE
MELPMGTHAMDTPEGNTTSRSTPSSETHRGYSFDFLYDFTSRTGLVDSFECGTHAQRRAV
VDAFYASYAEQQKHHQQLQQIQQQQQQQQQHLQAQQQIQGQLEFHPMFPQLQNHMGQPPL
SPASSSAVSTSATSNDYSYMPWTPWSSWLSNPIIIKLQEIVVSIMNVVRHKPSNSTLGTL
TWTPDKEQECLQLFSPQRFAKFLELFWSCWHPNVNFMHRPSFDPTSAKPTLLAAMALTGN
DTEPGSPADDDANPTSALHCKRKLQALQASYIVCLYQNWEGSDASKRRIRRHRFNTVVSV
ARDIGIPMAKHLEYGRLLRHEFDWHEYVVREELIRTFLWVFLLDTAFVIFNNLPHRMVIK
EMRMHMASPEAVFQAPTAEKCLEEIYQWMPSSSPICNTLLRDVLENVIGTTLDADTLQRL
ARLGPLNLFVVVSVFHYMIFQHQNLFGVEGQLVPIRNGLDNWITIWELWCDHWSSTPPHC
MAASDNLTPANMWKRIGFIRCSAEYWLLGSLLTDRIARKTSGGVRENQGKGSSPDCYPDE
LTGSGKGKSNDPILIKYDQTSMRQVNELISDFKKIQLEENE
Download sequence
Identical sequences F8N4C3
jgi|Neute1|106365|estExt_Genewise1.C_270034 XP_009855511.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]