SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|157217|estExt_fgenesh1_pg.C_90146 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|157217|estExt_fgenesh1_pg.C_90146
Domain Number 1 Region: 10-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000355
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 2 Region: 77-119
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000101
Family Zn2/Cys6 DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|157217|estExt_fgenesh1_pg.C_90146
Sequence length 337
Sequence
MPPKTLRQPVFFCIHCGNKFTRKEHLERHIASHTGARPWSCVHCFMPFGRQDLLRRHLKI
YHSVSDDLDPIPPQTGAHKPDVACQPCHKAKCQCDKQKPTCGACKKKGITCVPRESRRVV
KQETRARRSAAPQQPPPPAQVPLPAQPARDEQNQQEPVMEASLETMIDGEAYQQERRASH
IQQGLYQGTGPQSSFIPQVPLTRNLAPGVGFPNFYGFSNPTSYGGFDGYGNPIQSFGPKP
THLGSQNDPSLNIPDLSPGSLNIPDLSPGSLNIPDLSPGSSTSIETGFETLDDIPDMNGF
SGYGEVVVNGNNHHSLAGEGTVPWSWETNSLNGYGYM
Download sequence
Identical sequences F8MCU6 G4UH94
XP_009848420.1.73169 jgi|Neute1|157217|estExt_fgenesh1_pg.C_90146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]