SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|188388|estExt_fgenesh2_kg.C_30056 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|188388|estExt_fgenesh2_kg.C_30056
Domain Number 1 Region: 93-168
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.71e-32
Family Skp1 dimerisation domain-like 0.0000293
Further Details:      
 
Domain Number 2 Region: 11-77
Classification Level Classification E-value
Superfamily POZ domain 1.1e-20
Family BTB/POZ domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|188388|estExt_fgenesh2_kg.C_30056
Sequence length 171
Sequence
MAENDERALQKVSLQSNDGQIITVDRVVAERSLLIKNLIEDLGDEAVMNEAIPLPNVNEP
VLRKVVEWCEHHRKDPPQTTEDENDSRKKSTEIDEWDQKFMQVDQEMLFEIILAANYMDI
KPLLDVGCKTVANMIKGKSPEEIRKTFNITNDFTPEEEEQIRRENEWAEDR
Download sequence
Identical sequences A0A0B0DPG4 F8MKE6 G4UNM1 Q8NK13
NCU08991T0 NCU08991T1 5141.NCU08991.1 jgi|Neudi1|166794|estExt_fgenesh3_kg.C_50060 XP_009851282.1.73169 XP_011393972.1.24337 XP_011393973.1.24337 jgi|Neute1|188388|estExt_fgenesh2_kg.C_30056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]