SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376266653|ref|YP_005119365.1| from Bacillus cereus F837/76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376266653|ref|YP_005119365.1|
Domain Number 1 Region: 26-284
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.91e-81
Family Phosphate binding protein-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|376266653|ref|YP_005119365.1|
Sequence length 285
Comment glycine betaine ABC transporter substrate-binding protein OpuAC [Bacillus cereus F837/76]
Sequence
MRKKIWFICLALFITMIFTSCNATNANSKGKIKLGVTSWKENIATANMWKVLLEQKGYKV
ELMYLEKAAIWTGVARGDVDANLEVWLPVTDKPLNNRYKDDIVLKSKWYEGTGLGLVVPS
YMKNISSIEDLNTHKDELDNKIIGIEPGSSLMNLTNKAMKKYDIKLKLVQSSEAALMSEL
KKAYTKKKPIAVTLWNPHWGFSEFDLKYLKDPKKVYGEKDDIYYSVRKGFEKDHPDIIKY
FDKWKMNDEQLGTLMVELNKTKDPEEAARKWIKKNQALVDEWIKD
Download sequence
Identical sequences A0REZ8 C2NIP2
412694.BALH_2504 gi|376266653|ref|YP_005119365.1| WP_001227638.1.24676 WP_001227638.1.33828 WP_001227638.1.3699 WP_001227638.1.46476 gi|118478147|ref|YP_895298.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]