SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448236604|ref|YP_007400662.1| from Geobacillus sp. GHH01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448236604|ref|YP_007400662.1|
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily AF1862-like 1.57e-32
Family Cas Cmr5-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|448236604|ref|YP_007400662.1|
Sequence length 134
Comment CRISPR-associated protein [Geobacillus sp. GHH01]
Sequence
METNVKRVGIENGRAAFAFQEVKQAKERLRGSFENYRSYVKKMPSLIQVNGLGQALAFCF
QKGKEYKAIYQSLAKWMREQFPDQFSSANQELVEAVVNLSSVDYRLWTMEAMALLDWMRK
FADGMAKDDAKAAE
Download sequence
Identical sequences A0A063Z078 L7ZVX0
gi|448236604|ref|YP_007400662.1| WP_015373850.1.17728 WP_015373850.1.19233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]