SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448237281|ref|YP_007401339.1| from Geobacillus sp. GHH01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448237281|ref|YP_007401339.1|
Domain Number 1 Region: 190-584
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.24e-95
Family beta-Lactamase/D-ala carboxypeptidase 0.00000312
Further Details:      
 
Domain Number 2 Region: 55-239
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 5.36e-44
Family Penicillin binding protein dimerisation domain 0.0000761
Further Details:      
 
Domain Number 3 Region: 657-709
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0072
Further Details:      
 
Domain Number 4 Region: 600-653
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000458
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|448237281|ref|YP_007401339.1|
Sequence length 736
Comment penicillin-binding protein 2B [Geobacillus sp. GHH01]
Sequence
MEARKHRNTHQGAFILFCLFGFLFSLLFARFVQLEWTGKADGQTLAVIAERQHQQTRTIK
AKRGTIFDRNGAILAEDVPSYTVVAILDPKMTTDPDHPHHVVDPKKTAEQLAPLLGMDVE
AMERILTKKAKQVEFGAYGRNISFELKRKIEALHLPGIAFIRDTSRFYPNGMFASHVIGY
AQKNAANETVGKMGVEKELDRYLREEDGYVSFAGDINGFRLPGGKERIVKPDNGANVYLT
IDGKIQSFLEDAMNSVEKQYKPKKMIAIVADPKTGKILAMATRPSFDPNKRDITNFLNDA
ISYPYEPGSTMKVFTLAAAINEGVYNGNETYRSGSYKVGPNTIRDHNDVGWGTITFNEGV
QRSSNVAFSILVKEKLGEDRFLQYLHRFHFDRKTGIDLPNEAVGQIRYRYPIERITTGFG
QGTSVTPIQQIQAATAIANDGKMMKPYVIEKVVDPDSGKVVLDHGPTVVGEPITAETARK
VRAILETVVTSEHGTGRPYQINGYRVAGKTGTAQIPSASGGYLTGRENYIFSFLGMAPTD
DPKLLMYVAVQQPHLDVTETGAAPVSQIFTTVMKSSLQYLHIEPNGEKRMKAKTAQPQAL
DSWIGQPAASAAKQLKEKGYVPVVIGRGKYVEQQLPQGGDHVLLGERVVLKTDGAATMPD
LRGFSLRDAMKVAHILGLRPSTKGTGYVVSQNIRPGSEVRKGDYLIVELAPPRQWEKEAA
EKEKEAALRKEAEPHE
Download sequence
Identical sequences L7ZQ24
gi|448237281|ref|YP_007401339.1| WP_015374354.1.17728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]