SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448237282|ref|YP_007401340.1| from Geobacillus sp. GHH01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448237282|ref|YP_007401340.1|
Domain Number 1 Region: 170-568
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.59e-104
Family beta-Lactamase/D-ala carboxypeptidase 0.0000259
Further Details:      
 
Domain Number 2 Region: 52-219
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 8.24e-48
Family Penicillin binding protein dimerisation domain 0.00091
Further Details:      
 
Domain Number 3 Region: 583-635
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|448237282|ref|YP_007401340.1|
Sequence length 644
Comment penicillin-binding protein [Geobacillus sp. GHH01]
Sequence
MRVSYVTVRKRLTIVFLIGILIFAIIDLRLGYVQFWLGDLLAERAKGLWGRNIPFEPKRG
EILDRNGVPLATNMSAPTVYVIPRQVKNPAEAAKKLAGVLGGSIESIYKQITQKTSIVRL
KEGRKISDEKAANVRSLDLDGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLTGLELYYD
KELRGERGSVQFYSDAKGRRMPDIADDYTPPTDGLNLVLTIDSRIQTIIERELDIAEAKY
NPDGIIAIAMDPNTGEILAMASRPTFNPADYRSVPPEIYNRNLPIWSTYEPGSTFKIITL
AAALEEHKVNLLKDHFFDPGYAKVAGATLRCWKKGGHGDQTFLEVVQNSCNPGFVELGER
LGKETLFRYIKQFGFGEKTGIDLQGEGTGILFDLKRVGPVELATTAFGQGVSVTPIQQVA
AVSAAINGGILYTPYIAKQWVDPETGEIVRRNTPKAKRRVISEETSKQVRYALESVVAQG
TGKKAYVEGYRVGGKTGTAQKAQGGRYLQNNHIVSFIGFAPADDPKLVVYVAVDNPKGTV
QFGGTVAAPIVGKIMEDSLRTLGVKPRKDQLEKERDWNEPKVIEVPNLIGMTKNDLQEQL
FDLKLDVSGEGDVVVEQSPKPGAKVKEGSTVRIYLAKREAAEER
Download sequence
Identical sequences A0A1V9C0G1 L7ZWU4
gi|448237282|ref|YP_007401340.1| WP_015374355.1.17728 WP_015374355.1.70239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]