SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448237333|ref|YP_007401391.1| from Geobacillus sp. GHH01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448237333|ref|YP_007401391.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-86
Family Protein kinases, catalytic subunit 0.000000985
Further Details:      
 
Domain Number 2 Region: 500-562
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000968
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|448237333|ref|YP_007401391.1|
Domain Number - Region: 364-425
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 432-488
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0667
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|448237333|ref|YP_007401391.1|
Sequence length 656
Comment serine/threonine-protein kinase [Geobacillus sp. GHH01]
Sequence
MLIGKRLNDRYKIISLIGGGGMANVYLARDIILERDVAVKVLRLDFANDDQFIKRFRREA
QAATSLNHEHIVSIYDVGEEEGVYYIVMEYVRGATLKQYIQQHAPLPVERALGIMDQLTS
AIAHAHENGIIHRDIKPQNILLDEHGNVKVTDFGIAVAMSGTTITQTNSVLGSVHYLSPE
QARGGIATEKSDIYSLGIVMFELVTGRLPFSGESAVSIVLKHLQAETPSPKAWNPDIPQS
VENIILKATAKDPFYRYQSAREMNEDIRTALDPRRRNEPKFTIPDDDEEATKAIPMIKHA
ESAALEQETLVYEEKTSEPVHTTGEPKPKRKRVWIAWLVAALLFIGAAGVSAVTWIPDLI
FPKEVTMPNVVNKNYDDAVEQLSSLGLEIKDTIDVEDDQIEEGKVVRTDPEAGMTVKKGA
GVIIYKSIGKKKIEFPSFIGDDIAAAEEELRAEGFTRITRNGRHSDKPEGTILDQYPYAG
DRVAPDETEVIFTVSLGPEKVTVKDLTGYTEKSVRDYGADQGLRIDVKYEYSDEVPEGLV
ISQTPAANEQVKKGETITVVISRGPEPKPSKTVVKEIMIPYEPAMPGQMVEAQLYIQDAN
HNMSTPYKTYRLTAPATEMVEFEIPYGETAYYRVIVNNVVKEEGSIPYPEHNEKKG
Download sequence
Identical sequences A0A142CZA8 A0A1V9C8I2 L7ZVC5
WP_015374390.1.17728 WP_015374390.1.20723 WP_015374390.1.38928 WP_015374390.1.92435 gi|448237333|ref|YP_007401391.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]