SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448237462|ref|YP_007401520.1| from Geobacillus sp. GHH01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448237462|ref|YP_007401520.1|
Domain Number 1 Region: 256-556
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.1e-92
Family DNA repair protein MutS, domain III 0.00000126
Further Details:      
 
Domain Number 2 Region: 558-790
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.86e-66
Family ABC transporter ATPase domain-like 0.000000384
Further Details:      
 
Domain Number 3 Region: 2-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.57e-43
Family DNA repair protein MutS, domain I 0.0000168
Further Details:      
 
Domain Number 4 Region: 114-268
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 7.98e-31
Family DNA repair protein MutS, domain II 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|448237462|ref|YP_007401520.1|
Sequence length 903
Comment DNA mismatch repair protein [Geobacillus sp. GHH01]
Sequence
MPSYTPMIQQYLHIKAQYPDAFLFFRLGDFYELFFDDAIKAAQELEITLTSRDGGGDERV
PMCGVPYHSAQGYIEQLIEKGYKVAICEQVEDPKTAKGVVRREVVQLITPGTLMEGKGLT
EKENHYLAALTPFADGTYGLAYADLSTGEVRLTLLSSWEEAANELHAVGAREIIVATDSG
EEWVRELKERYGAAVSYEDDTSLCDEWNGVIGHVAQEKLRQAAARLLHYLVRTQKRRLDH
LQPAELYQVDHYMKMDRHSKLHLELVETVRSKGRKGSLLWLLDETVTAMGGRLLKQWLDR
PLIDRREIERRLDFVETLKTSYFERQELRDRLRGVYDIERLVGRVSYGNANARDLVQLKK
SLLQVPALRQTVGALPLAEADKLCERLDPCEELVDLLERSIQEQPPLSVKEGNLIKDGYD
KQLDRYRDASRNGKAWIAELEAKEREATGIKSLKVGYNRVFGYYIEVTKPNLPLVPEGRY
ERKQTLANAERFITPELKEKEALILEAEEKSIELEYELFVAIREQVKQYIPRLQTLAKAI
AELDVLQSFATISDEYRYVRPQFSTERVLVIQGGRHPVVEKVLGAQMYVPNDCYMNRERE
MLLITGPNMAGKSTYMRQVALTAVMAQIGCFVPAERAVLPIFDQVFTRIGAADDLSAGQS
TFMVEMLEARHAIAHATQNSLILFDEIGRGTSTYDGMALAQAIIEYIHDHIGAKTLFSTH
YHELTALERSLPRLSNVHARAIEENGKVVFLHQIADGPADKSYGIHVAELAGLPASLIER
ARAILAELEKAAGKQEAAAGRMDDGALAEAGLAFQGNEALDVGSKVEREKASRPSAGAAR
EGVLAEAAFEQLSMFPDLAPAPVEPPLSSKEKKALAALKEINLLEMTPLEALNKLYELQK
LLK
Download sequence
Identical sequences A0A0E0TAC7 L7ZXA0
544556.GYMC61_2095 gi|319766326|ref|YP_004131827.1| gi|448237462|ref|YP_007401520.1| WP_013523438.1.17728 WP_013523438.1.50933 WP_013523438.1.80994 gi|261419511|ref|YP_003253193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]