SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448238979|ref|YP_007403037.1| from Geobacillus sp. GHH01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448238979|ref|YP_007403037.1|
Domain Number 1 Region: 301-521
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-46
Family ABC transporter ATPase domain-like 0.0000559
Further Details:      
 
Domain Number 2 Region: 31-296
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.32e-28
Family DNA repair protein MutS, domain III 0.01
Further Details:      
 
Domain Number 3 Region: 715-791
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000000275
Family Smr domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|448238979|ref|YP_007403037.1|
Sequence length 792
Comment DNA mismatch repair protein [Geobacillus sp. GHH01]
Sequence
MNQLGVRYVQRKVLHTLEFDKVKEQLAEHASSPLGLEKIDALIPSSDLEEVAAWLDETDE
AAAVLRLAGYAPLDGVVDIRPHLKRAAIGGTLSPQELLEVAATSAASRQMKRLIMDLHEE
HGGLDRLSTYADELVEVPALEHDIRRSIDDHGEVLDAASDRLRSLRGQIRSVEARIREKL
ENIIRSPSAQKRLSDAIITIRNDRYVIPVKQEYRGAYGGIVHDQSASGATLFIEPQAVVE
LNNALREARAKEKQEIERILRELSAKVAEQAEPLARAVESLAALDFAFAKAKYARRLQAA
KPAVNSRGYLRFLQARHPLLDQEKAVPNDIELGGDYTTIVITGPNTGGKTVTLKTIGLLT
LMAQAGLFIPAADGSEAAVFRSVFADIGDEQSIEQSLSTFSSHMVNIVDILRHVDGESLV
LFDELGAGTDPQEGAALAIAILDEVHGRGSRTVATTHYPELKAYGYNRPGVVNASVEFDT
ETLRPTYKLLIGIPGRSNAFDISRRLGLDERIIERAKAQVSAESHNVENMIASLERSKKQ
AEEEEARARAALEEAERLRAEWEQKWEELEEEKAERLAEATQKAADIIRAAEREAERIIQ
ELRRLQKEKQAEVKEHELVEAKKRLAAAMPKVEKRKKAKKAASRHVFQPGDEVKVTSLNQ
KGYLIEKVSDDEWQVQLGILKMKIRERDLEYIGSAPANDVTPIATVKGKDAHVSLELDLR
GERYEDALLRLEKYLDDAVLAGYARVSIIHGKGTGALRQGVQQFLKQHRAVKSFRFGEAN
EGGTGVTIVELK
Download sequence
Identical sequences L8A2K3
WP_015375561.1.17728 gi|448238979|ref|YP_007403037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]