SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448239398|ref|YP_007403456.1| from Geobacillus sp. GHH01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448239398|ref|YP_007403456.1|
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily FlgN-like 3.01e-22
Family FlgN-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|448239398|ref|YP_007403456.1|
Sequence length 155
Comment flagellar protein [Geobacillus sp. GHH01]
Sequence
MTFAPLIRLLRAHSELYESLLALSRRKTEALKKNDIEALSALLADEQKHILAIRQLEERR
QRWLKETLGDEAATLSRCMDLAKGKEREELRECQARLQTAVNAVAEANELNRQLIEQSLQ
FVTAMLETFAPTPSTYSRTQQYAPSPERPLFESKA
Download sequence
Identical sequences L8A198
gi|448239398|ref|YP_007403456.1| WP_015375852.1.17728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]