SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448236402|ref|YP_007400460.1| from Geobacillus sp. GHH01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448236402|ref|YP_007400460.1|
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.4e-31
Family Ribosomal L11/L12e N-terminal domain 0.0000634
Further Details:      
 
Domain Number 2 Region: 67-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.01e-27
Family Ribosomal protein L11, C-terminal domain 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|448236402|ref|YP_007400460.1|
Sequence length 141
Comment 50S ribosomal protein L11 [Geobacillus sp. GHH01]
Sequence
MAKKVIKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNARTADQAGLIIPVEITV
FEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAAS
IEAAMRMIEGTARSMGIVIED
Download sequence
Identical sequences A0A063YXP9 A0A063YYD4 A0A098KZF5 A0A0D8BQR5 A0A0E0T7F0 A0A0J0V907 A0A0K2H8W1 A0A1Q5T1Q0 A0A223ER82 G8N0Z0 L7ZUA3 Q5L421 T0NZK8 V6VHI8
235909.GK0093 544556.GYMC61_0094 gi|319765252|ref|YP_004130753.1| gi|261417594|ref|YP_003251276.1| gi|375006905|ref|YP_004980535.1| gi|297528469|ref|YP_003669744.1| gi|448236402|ref|YP_007400460.1| gi|56418628|ref|YP_145946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]