SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|448239099|ref|YP_007403157.1| from Geobacillus sp. GHH01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448239099|ref|YP_007403157.1|
Domain Number 1 Region: 2-165
Classification Level Classification E-value
Superfamily ITPase-like 1.35e-47
Family YjjX-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|448239099|ref|YP_007403157.1|
Sequence length 176
Comment DUF84 family protein [Geobacillus sp. GHH01]
Sequence
MKTVAVGTNNEAKIAAVRAVLSEKEYRIVSLEVPSGVSAQPLSDEETRLGAIGRAKRALE
AAEADIGIGLEGGVTKIDGQWWLCNWGALADRNGVVVAAAGARLALPPDVGAGIEAGREL
GDVMEAYTGRRNVRRKEGAVGVLTNGRVDRSAMFSHIVELLAGQYEWLCQNGSFHV
Download sequence
Identical sequences A0A0E0TEN8 A0A0K2H7U2 A0A1V9CMZ1 G8N5K3 L8A300 U2Y5G6
gi|448239099|ref|YP_007403157.1| gi|261418164|ref|YP_003251846.1| gi|319767876|ref|YP_004133377.1| WP_013524367.1.17728 WP_013524367.1.50933 WP_013524367.1.59104 WP_013524367.1.80994 WP_013524367.1.8599 WP_013524367.1.90668 WP_013524367.1.91533 WP_013524367.1.92435 WP_013524367.1.93593 APC35586 544556.GYMC61_0688 gi|375009942|ref|YP_004983575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]