SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|406707578|ref|YP_006757930.1| from alpha proteobacterium HIMB59

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|406707578|ref|YP_006757930.1|
Domain Number 1 Region: 77-337
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.03e-39
Family L-arabinose binding protein-like 0.00068
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000103
Family GalR/LacI-like bacterial regulator 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|406707578|ref|YP_006757930.1|
Sequence length 340
Comment periplasmic solute-binding protein,transcriptional regulator, LacI family [alpha proteobacterium HIMB59]
Sequence
MRIVNIIELAKKLNLSITTVSRALGGYSDVSEVTRKRVMDFAKKHNYNPNPYASNLASHK
SNAVGFVIPLYGLNNNTLNQISYFKFVAGMSTKINQDNILFYMLFANSAKEEMESYKKLV
EVNKVKNIIIHNVQTDDKRIEYLNSKKINFVAWGRSKKIDYSWVDLDNELATELIVDYLY
SKGHQSFAFINVSEKYNFAHLRKKGFQKALKKHSLKFDKSLYQTTSLEDPSFSKEITINL
FKKNPELNCIICSTEYSSVGAIQACAELNKKIGEDISIITFDGPVVESLTNPKLTAISHP
LEELGTNAINILLGTEKKKQLSNYLVKPHIIERGSVKSLI
Download sequence
Identical sequences J9YYV2
gi|406707578|ref|YP_006757930.1| WP_014954584.1.36692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]