SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336112738|ref|YP_004567505.1| from Bacillus coagulans 2-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336112738|ref|YP_004567505.1|
Domain Number 1 Region: 3-241
Classification Level Classification E-value
Superfamily Hsp33 domain 4.45e-79
Family Hsp33 domain 0.0000000156
Further Details:      
 
Domain Number 2 Region: 232-290
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 4.05e-21
Family HSP33 redox switch-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336112738|ref|YP_004567505.1|
Sequence length 293
Comment Hsp33 protein [Bacillus coagulans 2-6]
Sequence
MADYLIKALAYDGQVRAYAADTTETVGEAQRRHYTWPTASAALGRTLTAGAMMGAMLKGD
EKITIKVEGGGPIGVILADANAHGEVRGYVTNPQTHFDLNKKGKLDVRRAVGTDGTLTVV
KDLGLREHFSGQVPLVSGELGEDFTYYFAASEQVPSAVGVGVLVNPDNTILAAGGFIIQL
MPGTDEKVISEIENKISDTAPISELIREGLSPEEILANLLGKENVQILEKMAVRFECTCS
KEKFASAMIGLGKQELRDMIEEDGQAEAVCHFCREKYHFSREDLEQMLEEAKG
Download sequence
Identical sequences F7Z163
gi|336112738|ref|YP_004567505.1| WP_013858024.1.42541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]