SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336114825|ref|YP_004569592.1| from Bacillus coagulans 2-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336114825|ref|YP_004569592.1|
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000012
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336114825|ref|YP_004569592.1|
Sequence length 156
Comment transcription activator effector binding protein [Bacillus coagulans 2-6]
Sequence
MEIQIVQKHAFNAVGSKWTGTFEQAANGDIKRFFHQFKQKMGEIRHCTDPGVVTGLSYHP
QDDEGLFSFYLVREVAYIEAVPEGMTALTVPSYTFAAAKYKGKGVQKAYAELYKWIRKNG
YTVFQGQLEHREDYPATYEPLSDEPELTIYIPLYIE
Download sequence
Identical sequences F7Z5N7
WP_013860097.1.42541 gi|336114825|ref|YP_004569592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]