SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402555326|ref|YP_006596597.1| from Bacillus cereus FRI-35

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402555326|ref|YP_006596597.1|
Domain Number 1 Region: 338-567
Classification Level Classification E-value
Superfamily PHP domain-like 9.03e-57
Family PHP domain 0.001
Further Details:      
 
Domain Number 2 Region: 154-316
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.05e-45
Family DNA polymerase beta-like 0.0033
Further Details:      
 
Domain Number 3 Region: 2-79
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.19e-20
Family DNA polymerase beta, N-terminal domain-like 0.003
Further Details:      
 
Domain Number 4 Region: 48-145
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0000000178
Family Achaeal helicase C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|402555326|ref|YP_006596597.1|
Sequence length 572
Comment hypothetical protein BCK_12480 [Bacillus cereus FRI-35]
Sequence
MKVNKKQVIKLLETIGLFMELKGANPFKISAFRKAAAALESDDRSLSEIEDFTKIPGIGK
GTAAVIQEYIESGTSEVLQELEKEVPSSLLPLLKLPGLGGKKVAKLYKELGVVDMESLKA
VCEENKVQALAGFGKKTEEKILEAIDQVGSRPERLPIAMVLPIAGEIEEKLSNIAEVIRF
SRAGSLRRVRETVKDLDFIIATTEPAAVREHLLQFDNMIEVIASGDTKVSVRLQYEYDIS
IDFRLVKPEEFITTLHHFTGSKDHNVKMRQIAKDKGEKISEYGVENLETGEVKTFETEEE
FFAHFGLPFIPPEVREDGKEIELIKEYPNLIQFSDIQGDLHMHTTWSDGAFSIEEMVQAC
RARGYKFMAITDHSQYLKVANGLTKERLCEQAKEIERMNEKYPDITILRGIEMDILPDAS
LDFDDEVLAELDYVIGAIHSSFSQDRETIMKRLRAALENKHVTMIAHPTGRLLGRREGYD
VDTDLLIELAKETNTVLELNANPNRLDLSAKLLKQAQDAGVKVAINTDAHTLEMLEDMET
GVAAARKGWIQKDNVINTWDIERLLDYIKRNK
Download sequence
Identical sequences gi|402555326|ref|YP_006596597.1| WP_000867536.1.80571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]