SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386756919|ref|YP_006230135.1| from Bacillus sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386756919|ref|YP_006230135.1|
Domain Number 1 Region: 627-794
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.8e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 4-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.38e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0017
Further Details:      
 
Domain Number 3 Region: 143-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.17e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.003
Further Details:      
 
Domain Number 4 Region: 513-635
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.89e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386756919|ref|YP_006230135.1|
Sequence length 805
Comment assimilatory nitrite reductase subunit [Bacillus sp. JS]
Sequence
MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNRILLSKVLQGDTDIKD
ITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDSDRIQPYDELILATGSVPFILPIPG
ADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARGLLNLGMEVSVIHLAPFL
MERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGLRFKDGTSIEADLVVMAVG
IRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KHICGIDTKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKKAIKVFDEQDGIYKKIVLRGN
QIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPLDQEAGTSITAAMSDDEIICGC
NGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKPLVEEILQHTLGSDFDASAQKEA
ICSCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPEGCSKCRPALNYYLGMINPTKYED
ERTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLHTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTN
EEVLEYAGAYLQYYRETANYLERTSAWLERVGLSHVQSVLNDPKKRQELNDRMNETLSVH
KDPWKDFLEDKQTSKELFENVVTTS
Download sequence
Identical sequences A0A292GN27 I0F073
WP_014662718.1.22408 WP_014662718.1.77994 WP_014662718.1.91225 gi|386756919|ref|YP_006230135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]