SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386757520|ref|YP_006230736.1| from Bacillus sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386757520|ref|YP_006230736.1|
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 3.66e-49
Family Hypothetical protein YfhH 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386757520|ref|YP_006230736.1|
Sequence length 104
Comment hypothetical protein MY9_0941 [Bacillus sp. JS]
Sequence
MEKRYSQMTPHELNTEIALLSEKARKAEQHGIINELAVLERKITMAKAYLLNPEDYSPGE
TYRVEGTEDEFTISYLNGVFAWGYRTSSPQQEEALPISVLKEKE
Download sequence
Identical sequences I0F1X4
gi|386757520|ref|YP_006230736.1| WP_014663265.1.91225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]