SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386758236|ref|YP_006231452.1| from Bacillus sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386758236|ref|YP_006231452.1|
Domain Number 1 Region: 194-592
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.17e-93
Family beta-Lactamase/D-ala carboxypeptidase 0.00000553
Further Details:      
 
Domain Number 2 Region: 59-242
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 7.06e-46
Family Penicillin binding protein dimerisation domain 0.000037
Further Details:      
 
Domain Number 3 Region: 601-655
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0062
Further Details:      
 
Domain Number 4 Region: 659-713
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000114
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386758236|ref|YP_006231452.1|
Sequence length 716
Comment penicillin-binding protein 2B [Bacillus sp. JS]
Sequence
MIQMPKKNKFMNRGAAILSICFALFFFVILGRMAYIQITGKADGEVLATKATEQHEKKRT
IEASRGSILDRNGKVIAEDTATYKLIAILDKKMTTDVKHPQHVVDKEKTAEALSKVINLD
KADILDILNKDAKQVEFGSAGRDITYSQKQKIEKMKLPGISFLRDTKRYYPNGIFASNLI
GYAEVDQDTNEISGAMGLEKVLDKYLKERDGYVTYESDKSGWELPNSKNKITAPKNGDNV
YLTIDQKIQTFLEDSMTKVAQKYNPKKIMAAVVDPKTGKVLAMGQRPSFDPNKRDVTNYY
NDLISYAYEPGSTMKIFTLAAAMQENVFNANEQYKSGTFEVGGAPVRDHNNGVGWGPTTY
HDGVLRSSNVAFAKLAKEKLGYDRLNQYLHKFNFYQKTGIDLPGEVSSKINFKYEFDKAS
TAYGQASAVTPIQQIQAATAIANDGKMMKPYVIDHIVDPDKDKTIYQNKPESAGTPISAS
TAKKVRDILGEVVTSKIGTGQAYKIEGFDVAGKTGTAQIAGKGGYLDGTDNYIFSFMGMA
PKDDPELLIYVAVQQPQLKAGQSSSDPVSEIFNPTMKNSLHYLNIEPTEKSDSDKEETKA
QTMPDLTDQTVTAAQKKAKEENLTPIVIGSDVAVKEQYPKADEEVLTNQKVFLKTGGKIK
MPDMTGWSRREVLQYGELAGIHIEVNGQGYAVSQSVKKDKEIKDKTVIKVQFKNPD
Download sequence
Identical sequences I0F3Z0
WP_014663882.1.91225 gi|386758236|ref|YP_006231452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]