SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386758237|ref|YP_006231453.1| from Bacillus sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386758237|ref|YP_006231453.1|
Domain Number 1 Region: 171-569
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.71e-101
Family beta-Lactamase/D-ala carboxypeptidase 0.0000364
Further Details:      
 
Domain Number 2 Region: 52-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.66e-44
Family Penicillin binding protein dimerisation domain 0.00084
Further Details:      
 
Domain Number 3 Region: 584-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000654
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386758237|ref|YP_006231453.1|
Sequence length 646
Comment stage V sporulation protein D [Bacillus sp. JS]
Sequence
MRVSNVTVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERG
EILDRNGVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVLNMSEEKVYKHVTKKASIEKI
TPEGRKISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYY
DDDLKGEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTILERELDNAEAK
YHPDGMIAVAMNPKNGEILGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIIT
LAAALEEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGE
RLGKEKLFKYIKDFGFGQKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVSVTPIQQV
AAVSAAVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEETSKQIRYALESVVAE
GTGRNAFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGT
IQFGGTVAAPIVGNIMRDSLPELGVKPRKNQIEKKYQWNDTKTIEVPNVVGMSVSDLESL
LVNLNVDASGKGSKIVKQSPAAGTKVKEGSKIRVYLTEEDEKEAAD
Download sequence
Identical sequences A0A2I7T6G6 I0F3Z1
WP_014663883.1.22408 WP_014663883.1.27155 WP_014663883.1.34750 WP_014663883.1.77994 WP_014663883.1.91225 gi|386758237|ref|YP_006231453.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]