SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386759375|ref|YP_006232591.1| from Bacillus sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386759375|ref|YP_006232591.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 6.41e-47
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 162-315
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.69e-39
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 318-420
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 2.75e-16
Family Glutamyl tRNA-reductase dimerization domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386759375|ref|YP_006232591.1|
Sequence length 455
Comment glutamyl-tRNA reductase [Bacillus sp. JS]
Sequence
MHILVVGVDYKSAPIEIREKVSFQPNELADAMVQLKEEKSILENIIVSTCNRTEIYAVVD
QLHTGRYYIKKFLADWFQLSKEELSPFLTFYESDAAVEHLFRVACGLDSMVIGETQILGQ
VRDSFKTAQQEKTIGTIFNELFKQAVTVGKRTHAETDIGSNAVSVSYAAVELAKKIFGNL
SSKHILILGAGKMGELAAENLHGQGIGKVTVINRTYLKAKELADRFSGEARSLNQLESAL
AEADILISSTGASEFVVSKEMMENANKLRKGRPLFMVDIAVPRDLDPALNDLEGVFLYDI
DDLEGIVEANMKERRETAEKVELLIEETIVEFKQWMNTLGVVPVISALREKALAIQSETM
DSIERKLPHLSTREKKLLNKHTKSIINQMLRDPILKVKELAADVDSEEKLALFMQIFDIE
EAAGRQMMKTLESSQKVHSFKKAESKAGFSPLVSE
Download sequence
Identical sequences A0A2I7SYG4 I0F779
WP_014664862.1.22408 WP_014664862.1.27155 WP_014664862.1.34750 WP_014664862.1.77994 WP_014664862.1.91225 gi|386759375|ref|YP_006232591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]