SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386760162|ref|YP_006233379.1| from Bacillus sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386760162|ref|YP_006233379.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily FlgN-like 1.12e-17
Family FlgN-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386760162|ref|YP_006233379.1|
Sequence length 160
Comment flagellar protein [Bacillus sp. JS]
Sequence
MSAKAIIEQLKRLCVLHEHLLTLSEEKTEALKAGKTKELSNLLTKEQKYIQAITQTEDDR
IKATSAFLGYSENNTITACIAKTSGSEREELEQLYESLSTVLGRLKKVNEMNRQLTRDAL
QFISISYDMLVPKENNFNYSKSIKAELPKSSRMKLFDSKA
Download sequence
Identical sequences A0A2I7T0K1 I0F9G7
WP_014665556.1.22408 WP_014665556.1.27155 WP_014665556.1.33083 WP_014665556.1.34750 WP_014665556.1.62713 WP_014665556.1.77994 WP_014665556.1.87192 WP_014665556.1.91225 gi|386760162|ref|YP_006233379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]