SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429216359|ref|YP_007174349.1| from Caldisphaera lagunensis DSM 15908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429216359|ref|YP_007174349.1|
Domain Number 1 Region: 24-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000987
Family GHMP Kinase, N-terminal domain 0.007
Further Details:      
 
Domain Number 2 Region: 198-250
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000863
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429216359|ref|YP_007174349.1|
Sequence length 259
Comment shikimate kinase [Caldisphaera lagunensis DSM 15908]
Sequence
MVRIQAKMHIAYAGVSIVNAIPCGIGAVLPINLKAFAKEGKRNRNSPLINAIEDYLIKNY
KIKTSFEVYSEIPEGVGLKSSSAVSVAIISSISHKLGDVYPPKLSAIITKNYNLSITGAF
DDAVASYEGKISFTDNINLKILKLEKPSHDLKVIIFINDKRHDLNLSLMRENCKSFKIAF
EKAFNGNIYEGIKINGYLMSEINGYDKKILDLMMEKGALTAGISGNGPAYFSLVKEGEEG
PILDYLSNKGKIIVSEVLK
Download sequence
Identical sequences L0AA23
gi|429216359|ref|YP_007174349.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]