SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384044285|ref|YP_005492302.1| from Bacillus megaterium WSH-002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384044285|ref|YP_005492302.1|
Domain Number 1 Region: 91-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-68
Family RecA protein-like (ATPase-domain) 0.0000000393
Further Details:      
 
Domain Number 2 Region: 51-126
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-24
Family Cold shock DNA-binding domain-like 0.0002
Further Details:      
 
Domain Number 3 Region: 4-49
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000000000361
Family Rho termination factor, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384044285|ref|YP_005492302.1|
Sequence length 424
Comment transcription termination factor Rho [Bacillus megaterium WSH-002]
Sequence
MNLTLSSLENMKLKELYEHAREYKVSYYSKLTKKELVFAILKAQAEQDGLLFMEGVLEII
QSEGFGFLRPINYSPSSEDIYISASQIRRFDLRNGDKVSGKVRPPKENERYYGLLHVEAV
NGEDPETSKERVHFPALTPIYPNEQMLLETQPRSFSTRIIDLISPIGFGQRGLIVAPPKA
GKTMLLKEIANSITTNHPDAELIVLLIDERPEEVTDIERSVDGDVVSSTFDEVPENHIKV
AELVLERAMRLVEHKKDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFG
AARNIEDGGSLTILATALIDTGSRMDDVIYEEFKGTGNMELHLDRSLAEKRIFPAIDIRR
SGTRKEELLIPKEHLDHLWAIRKSMADAPDFAEKFLKRLRQTKTNEEFFSMLTEEKKTLL
ANKR
Download sequence
Identical sequences A0A0H4RI93 A0A2C5GW24 G2RSB1
gi|384044285|ref|YP_005492302.1| WP_014457752.1.31602 WP_014457752.1.43466 WP_014457752.1.47795 WP_014457752.1.56431 WP_014457752.1.62029 WP_014457752.1.76027 WP_014457752.1.90160 WP_014457752.1.95734 WP_014457752.1.96672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]