SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384046452|ref|YP_005494469.1| from Bacillus megaterium WSH-002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384046452|ref|YP_005494469.1|
Domain Number 1 Region: 151-531
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.52e-73
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.01
Further Details:      
 
Domain Number 2 Region: 578-799
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.69e-41
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384046452|ref|YP_005494469.1|
Sequence length 953
Comment oxoglutarate dehydrogenase (Succinyl-transferring), E1 component [Bacillus megaterium WSH-002]
Sequence
MGNETSNRGEPWQGFLGPNYGYVLEQYELYEEQSDLIDPDLKELFDYWGAPPLNESEQVQ
QAEYAQAAPSANTSKIASAIKLAENIRAYGHLYASIKPLESEKKDPVLLHLEDYNLTQED
LKSIPVDILCTNAPSHVKNGLDAINYLTDVYTKTIAFEFHHVHNMEENKWLTDMVESGAI
FQPLSNEKRTSVLKRLTEVEGFEQFLHRTFVGQKRFSIEGVDMLIPLVDELIARSVETSP
KTVNIGMAHRGRLNVLAHVLGKPYEMIFAEFQHAPNKELVPSEGSIGINYGWTGDVKYHL
GADKQIKAENTVRARLTLASNPSHLEFVNPVVEGFTRAAQDERDVNGYPKQDVKKSFAIL
IHGDAAFPGEGIVQETLNLNQLTGYQTGGTIHIIANNMIGFTTESVDSRSTKYASDLAKG
FEIPIVHVNADDPEACLAAAYFAYEYRRRFNKDFLIDLIGYRRFGHNEMDEPSVTQPKMY
EIVTKRPTVRAMYAKQLEEQNVIQSGQADQINEELQAKLKAAYEKVPPKAEKQHRIMEMP
QAVFKGISDIDTSVTKEELFEVNQELVKYPEGFNVFPKLDRILSKRAKAFEENESVDWSL
GEAFAFATILRDGTPIRITGQDSERGTFAHRHLVLHDHKTGDVYSPLHAMKNVSASFDIR
NSPLSEGSVLGFEYGYNVFAPETLVLWEAQFGDFANAGQVIIDQFIAAGRAKWGQKSGMV
LLLPHGHEGQGPEHSSARLERYLQLAGENNWTIANVTSAAQYFHLLRRQAAILQREEVRP
LVVMTPKSLLRNAFSVSNLEEFTKGSFRLVVEQPGLGKKEDAVERIVLCSGKISSELTER
LNKAEDDKDWLHVLRLEQIYPFPRRVIAEIFARYKNLKEIVWLQEEPENMGAWNYVEDRL
REVAPEGATVDYIGRTRRSSPAEGDPTVHRQEQERILQDALTKNEIANDVVTR
Download sequence
Identical sequences G2RM38
gi|384046452|ref|YP_005494469.1| WP_014459541.1.90160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]