SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384174486|ref|YP_005555871.1| from Bacillus subtilis subsp. subtilis str. RO-NN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384174486|ref|YP_005555871.1|
Domain Number 1 Region: 9-328
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.14e-99
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384174486|ref|YP_005555871.1|
Sequence length 333
Comment TPP-dependent acetoin dehydrogenase alpha-subunit [Bacillus subtilis subsp. subtilis str. RO-NN-1]
Sequence
MELLKREGLSLTEEKALWMYQKMLEIRGFEDKVHDLFAQGVLPGFVHLYAGEEAVAVGVC
AHLHDGDSITSTHRGHGHCIAKGCDLDGMMAEIFGKATGLCKGKGGSMHIADLDKGMLGA
NGIVGGGFTLACGSALTAKYKQTKNVSVCFFGDGANNQGTFHEGLNLAAVWNLPVVFVAE
NNGYGEATPFEYASACDSIADRAAAYNMPGVTVDGKDILAVYQAAEEAIERARNGGGPSL
IECMTYRNYGHFEGDAQTYKTKDERVEHLEEKDAIQGFKNYLLKETDAGKLSDIEQRVSE
SIEKAVSFSEDSPYPKDSELLTDVYVSYEKGGM
Download sequence
Identical sequences WP_014476165.1.9164 gi|384174486|ref|YP_005555871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]