SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384175194|ref|YP_005556579.1| from Bacillus subtilis subsp. subtilis str. RO-NN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384175194|ref|YP_005556579.1|
Domain Number 1 Region: 11-365
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.47e-100
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000000000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384175194|ref|YP_005556579.1|
Sequence length 371
Comment pyruvate dehydrogenase E1 component, alpha subunit [Bacillus subtilis subsp. subtilis str. RO-NN-1]
Sequence
MAAKTKKAIVDSKKQFDAIKKQFETFQILNEKGEVVNEAAMPDLTDDQLKELMRRMVFTR
VLDQRSISLNRQGRLGFYAPTAGQEASQIATHFALEKEDFVLPGYRDVPQLIWHGLPLYQ
AFLFSRGHFRGNQMPDDVNALSPQIIIGAQYIQTAGVALGLKKRGKKAVAITYTGDGGAS
QGDFYEGINFAGAYKAPAIFVVQNNRYAISTPVEKQSAAETIAQKAVAAGIVGVQVDGMD
PLAVYAATAEARERAINGEGPTLIETLTFRYGPHTMAGDDPTKYRTKEIENEWEQKDPLV
RFRAFLENKGLWSEEEEAKVIEDAKEEIKQAIKKADAEPKQKVTDLMKIMYEKMPHNLEE
QFEIYTQKESK
Download sequence
Identical sequences A0A063XGA1 A0A0M0L1H2 A0A0T8PRZ5 A0A199WI90 A0A1J5XM06 A0A1Q9G2J6 A0A1V4FR79 A0A1X7DAP8 A0A285JZJ3 E0U3X6 G4EWU3 G4NWP2 L8AJ76 M4KRA5 P21881 U2ARR0
gi|321315217|ref|YP_004207504.1| gi|402775701|ref|YP_006629645.1| gi|430756061|ref|YP_007209841.1| gi|472329986|ref|YP_007662262.1| NP_389341.1.22788 WP_003222294.1.100042 WP_003222294.1.101446 WP_003222294.1.11231 WP_003222294.1.11257 WP_003222294.1.1140 WP_003222294.1.11581 WP_003222294.1.12759 WP_003222294.1.14761 WP_003222294.1.15902 WP_003222294.1.16291 WP_003222294.1.17079 WP_003222294.1.18944 WP_003222294.1.19261 WP_003222294.1.20099 WP_003222294.1.20502 WP_003222294.1.21045 WP_003222294.1.22408 WP_003222294.1.2546 WP_003222294.1.25531 WP_003222294.1.27155 WP_003222294.1.27371 WP_003222294.1.27372 WP_003222294.1.27660 WP_003222294.1.2914 WP_003222294.1.31028 WP_003222294.1.31100 WP_003222294.1.31260 WP_003222294.1.31786 WP_003222294.1.32001 WP_003222294.1.32219 WP_003222294.1.32420 WP_003222294.1.32861 WP_003222294.1.33083 WP_003222294.1.3320 WP_003222294.1.33846 WP_003222294.1.34242 WP_003222294.1.34322 WP_003222294.1.34621 WP_003222294.1.34750 WP_003222294.1.35833 WP_003222294.1.36189 WP_003222294.1.37074 WP_003222294.1.3747 WP_003222294.1.39562 WP_003222294.1.39605 WP_003222294.1.40859 WP_003222294.1.42762 WP_003222294.1.43852 WP_003222294.1.44140 WP_003222294.1.44184 WP_003222294.1.45019 WP_003222294.1.46869 WP_003222294.1.47157 WP_003222294.1.50592 WP_003222294.1.5262 WP_003222294.1.52860 WP_003222294.1.54596 WP_003222294.1.54948 WP_003222294.1.54949 WP_003222294.1.56085 WP_003222294.1.56274 WP_003222294.1.56411 WP_003222294.1.57156 WP_003222294.1.57184 WP_003222294.1.57201 WP_003222294.1.5726 WP_003222294.1.57513 WP_003222294.1.6139 WP_003222294.1.62713 WP_003222294.1.63795 WP_003222294.1.64557 WP_003222294.1.6517 WP_003222294.1.65188 WP_003222294.1.65223 WP_003222294.1.65841 WP_003222294.1.7186 WP_003222294.1.71916 WP_003222294.1.7204 WP_003222294.1.72152 WP_003222294.1.72516 WP_003222294.1.72999 WP_003222294.1.74782 WP_003222294.1.76814 WP_003222294.1.76977 WP_003222294.1.77994 WP_003222294.1.78686 WP_003222294.1.78811 WP_003222294.1.79046 WP_003222294.1.79633 WP_003222294.1.79712 WP_003222294.1.79987 WP_003222294.1.80832 WP_003222294.1.81116 WP_003222294.1.81747 WP_003222294.1.82722 WP_003222294.1.82789 WP_003222294.1.83369 WP_003222294.1.84183 WP_003222294.1.84556 WP_003222294.1.87192 WP_003222294.1.88042 WP_003222294.1.88382 WP_003222294.1.88591 WP_003222294.1.89000 WP_003222294.1.91060 WP_003222294.1.91133 WP_003222294.1.9164 WP_003222294.1.91723 WP_003222294.1.93073 WP_003222294.1.93400 WP_003222294.1.93420 WP_003222294.1.93618 WP_003222294.1.94199 WP_003222294.1.95009 WP_003222294.1.95507 WP_003222294.1.96043 WP_003222294.1.97264 WP_003222294.1.979 WP_003222294.1.99091 WP_003222294.1.99399 gi|350265762|ref|YP_004877069.1| gi|16078522|ref|NP_389341.1| gi|305674185|ref|YP_003865857.1| gi|384175194|ref|YP_005556579.1| gi|560128546|ref|YP_008829687.1| 224308.BSU14580 gi|449094154|ref|YP_007426645.1| gi|470161636|ref|YP_007533411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]